Align 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 (characterized)
to candidate PfGW456L13_3832 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7)
Query= SwissProt::Q57695 (289 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3832 Length = 291 Score = 172 bits (437), Expect = 6e-48 Identities = 98/289 (33%), Positives = 156/289 (53%), Gaps = 8/289 (2%) Query: 2 FKGVYPAIITPFKNKEVDFDGLEENINFLIENGVSGIVAVGTTGESPTLSHEEHKKVIEK 61 F+G++ ++TPF N +DF GL ++ L+E GV G++ GTTGE + E V++ Sbjct: 4 FQGIWVPLVTPFHNGAIDFVGLHRLVSHLLEKGVDGLIVCGTTGEPAAMGKHEQLAVLDA 63 Query: 62 VVDVVNGRVQVIAGAGSNCTEEAIELSVFAEDVGADAVLSI---TPYYNKPTQEGLRKHF 118 V++ V + V+ AG+N TE L F ++ V + PYY +P+Q GL F Sbjct: 64 VLERVPAQQVVMGLAGNNLTE----LLQFQSEILKRPVAGLLVPAPYYIRPSQAGLEAFF 119 Query: 119 GKVAESINLPIVLYNVPSRTAVNLEPKTVKLLAEEYSNISAVKEANPNLSQVSELIHDAK 178 VA++ ++P++LY++P RT V E T+ L + I A+K+ N S L++ Sbjct: 120 RTVADASSVPLILYDIPYRTGVAFEQATL-LNIVAHERIVAIKDCGGNFSNTLALLNSGL 178 Query: 179 ITVLSGNDELTLPIIALGGKGVISVVANIVPKEFVEMVNYALEGDFEKAREIHYKLFPLM 238 + VL G D + LG KG I+ A++ P+ FV++ + + R ++L PL+ Sbjct: 179 VDVLCGEDNQIFNALCLGAKGAIAASAHVHPELFVQLHRQIRDNQLAEGRATFFRLLPLI 238 Query: 239 KAMFIETNPIPVKTALNMMGRPAGELRLPLCEMSEEHKKILENVLKDLG 287 ++F+E NP PVKTAL + G ELR P+ SE + L+ VL LG Sbjct: 239 NSLFLEPNPAPVKTALALQGLIGDELRAPMQRSSEPMTERLKGVLSALG 287 Lambda K H 0.315 0.135 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 291 Length adjustment: 26 Effective length of query: 263 Effective length of database: 265 Effective search space: 69695 Effective search space used: 69695 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
Align candidate PfGW456L13_3832 (4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))
to HMM TIGR00674 (dapA: 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00674.hmm # target sequence database: /tmp/gapView.7112.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00674 [M=286] Accession: TIGR00674 Description: dapA: 4-hydroxy-tetrahydrodipicolinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-75 237.4 0.0 8.4e-75 237.2 0.0 1.0 1 lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3832 4-hydroxy-tetrahydrodipicolinate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3832 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 237.2 0.0 8.4e-75 8.4e-75 4 285 .. 9 285 .. 6 286 .. 0.97 Alignments for each domain: == domain 1 score: 237.2 bits; conditional E-value: 8.4e-75 TIGR00674 4 tAliTPfkedgsvdfaalekliesqiekgvdaivvvGtTGEsatLsleEkkkvie 58 + l+TPf++ +df l++l+++++ekgvd+++v+GtTGE a++ + E+ +v+ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3832 9 VPLVTPFHNGA-IDFVGLHRLVSHLLEKGVDGLIVCGTTGEPAAMGKHEQLAVLD 62 679****9887.******************************************* PP TIGR00674 59 vavelvknrvpviaGtgsnateeaieltkeaeklgvdgvlvvtPyYnkPtqeGly 113 ++e v +v+ G ++n+++e +++ +e+ k +v+g+lv +PyY +P+q Gl lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3832 63 AVLERVPA-QQVVMGLAGNNLTELLQFQSEILKRPVAGLLVPAPYYIRPSQAGLE 116 ******98.9********************************************* PP TIGR00674 114 khfkaiaeevelPiilYnvPsRtgvslepetvkrLaeeveivaiKeasgdlervs 168 ++f ++a+++++P+ilY++P Rtgv +e+ t+++++++++ivaiK+++g+ ++ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3832 117 AFFRTVADASSVPLILYDIPYRTGVAFEQATLLNIVAHERIVAIKDCGGNFSNTL 171 ****************************************************999 PP TIGR00674 169 eikaeakedfkvlsGdDaltleilalGakGviSVasnvapkelkemvkaalegdt 223 + + + vl+G+D+ + l+lGakG i ++v p+++ ++ +++ +++ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3832 172 ALLNSG--LVDVLCGEDNQIFNALCLGAKGAIAASAHVHPELFVQLHRQIRDNQL 224 998854..69********************************************* PP TIGR00674 224 eeareihqkllklfkalfietNPipvKtalallgliekdelRlPLtelseekkek 278 +e r +ll+l++ lf+e+NP pvKtalal+gli elR P+ se +e+ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3832 225 AEGRATFFRLLPLINSLFLEPNPAPVKTALALQGLIGD-ELRAPMQRSSEPMTER 278 ************************************98.**************** PP TIGR00674 279 lkevlke 285 lk vl+ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3832 279 LKGVLSA 285 **99975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (286 nodes) Target sequences: 1 (291 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.63 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory