Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate RR42_RS04455 RR42_RS04455 MFS transporter
Query= BRENDA::P23721 (362 letters) >FitnessBrowser__Cup4G11:RR42_RS04455 Length = 386 Score = 362 bits (929), Expect = e-105 Identities = 186/365 (50%), Positives = 247/365 (67%), Gaps = 9/365 (2%) Query: 3 QIFNFSSGPAMLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDLLN 62 +++NFS GPA LP EVL QA E+ W+G G SVME+SHR +EF + EA + R+LL Sbjct: 20 RVYNFSPGPAALPTEVLLQAADEMLSWHGSGVSVMEMSHRSREFESIQAEALANLRELLQ 79 Query: 63 VPSNYKVLFCHGGGRGQFAAVPLNIL----GDKTTADYVDAGYWAASAIKEAKKYCTPNV 118 VP N+++LF GG G+ VPLN++ D+ AD+V G W+ + +EA++Y N+ Sbjct: 80 VPKNFRILFLQGGAIGENGIVPLNLMRRVNADRPKADFVVTGTWSVKSEQEARRYGEVNI 139 Query: 119 FDAKVTVDGLRAVKPMREWQLSDNAAYMHYCPNETIDGIAIDETPDFG----ADVVVAAD 174 A T + + +W+LSD+AAY+H C NETI G+ + PD G VV AD Sbjct: 140 A-ATSTAQKFARIPDVADWKLSDDAAYVHLCTNETIVGVEFQDVPDIGQHRDGGPVVVAD 198 Query: 175 FSSTILSRPIDVSRYGVIYAGAQKNIGPAGLTIVIVREDLLGKANIACPSILDYSILNDN 234 SS ILSRP+D SR V Y GAQKNIGPAGLTIVIVREDLLG A+ CPS ++ ++ ++ Sbjct: 199 VSSHILSRPVDWSRVQVAYGGAQKNIGPAGLTIVIVREDLLGHAHPLCPSAFNWRLVAEH 258 Query: 235 GSMFNTPPTFAWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVAKAN 294 SM+NTPPT++ Y++GLVFKWLKA GGV +++ N K+ LY +D S FYRN++ + Sbjct: 259 DSMYNTPPTYSIYIAGLVFKWLKAQGGVGAIEQRNIAKSHALYEFLDQSAFYRNEIDPGS 318 Query: 295 RSRMNVPFQLADSALDKLFLEESFAAGLHALKGHRVVGGMRASIYNAMPLEGVKALTDFM 354 RSRMNVPF LAD + + FL + A GL LKGH+ VGGMRAS+YNAMP+EGV AL ++M Sbjct: 319 RSRMNVPFFLADESRNDAFLAGARANGLVQLKGHKSVGGMRASLYNAMPIEGVAALIEYM 378 Query: 355 VEFER 359 EFER Sbjct: 379 REFER 383 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 417 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 386 Length adjustment: 30 Effective length of query: 332 Effective length of database: 356 Effective search space: 118192 Effective search space used: 118192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate RR42_RS04455 RR42_RS04455 (MFS transporter)
to HMM TIGR01364 (serC: phosphoserine transaminase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01364.hmm # target sequence database: /tmp/gapView.31786.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01364 [M=358] Accession: TIGR01364 Description: serC_1: phosphoserine transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-147 477.3 0.0 1.4e-147 477.2 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS04455 RR42_RS04455 MFS transporter Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS04455 RR42_RS04455 MFS transporter # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 477.2 0.0 1.4e-147 1.4e-147 1 356 [. 21 383 .. 21 385 .. 0.98 Alignments for each domain: == domain 1 score: 477.2 bits; conditional E-value: 1.4e-147 TIGR01364 1 ivnFsaGPaalpeevlekaqkelldfnglglsvmeisHRskefekvveeaesdlreLlnipdnyevlfl 69 ++nFs+GPaalp+evl +a++e+l ++g+g+svme+sHRs+efe++ ea +lreLl++p+n+++lfl lcl|FitnessBrowser__Cup4G11:RR42_RS04455 21 VYNFSPGPAALPTEVLLQAADEMLSWHGSGVSVMEMSHRSREFESIQAEALANLRELLQVPKNFRILFL 89 59******************************************************************* PP TIGR01364 70 qGGattqfaavplnllkekk....vadyivtGawskkalkeakkltkevkvvaseeekkyskipdeeel 134 qGGa ++ vplnl+++ + +ad++vtG+ws k+ +ea+++++ v+++a++ +k+ +ipd ++ lcl|FitnessBrowser__Cup4G11:RR42_RS04455 90 QGGAIGENGIVPLNLMRRVNadrpKADFVVTGTWSVKSEQEARRYGE-VNIAATSTAQKFARIPDVADW 157 ****************955445679********************98.*******99************ PP TIGR01364 135 elkedaayvylcanetieGvefkelpevkk.....aplvaDlssdilsrkidvskygliyaGaqKniGp 198 +l++daayv+lc+neti Gvef+++p+ + ++vaD+ss+ilsr++d s+ ++ y+GaqKniGp lcl|FitnessBrowser__Cup4G11:RR42_RS04455 158 KLSDDAAYVHLCTNETIVGVEFQDVPDIGQhrdggPVVVADVSSHILSRPVDWSRVQVAYGGAQKNIGP 226 **************************999878888899******************************* PP TIGR01364 199 aGvtvvivrkdllerakkelpsvldYkilaendslyntpptfaiyvlglvlkwlkekGGvkklekknqe 267 aG+t+vivr+dll++a+ +ps ++++ +ae+ds+yntppt++iy++glv+kwlk++GGv ++e++n + lcl|FitnessBrowser__Cup4G11:RR42_RS04455 227 AGLTIVIVREDLLGHAHPLCPSAFNWRLVAEHDSMYNTPPTYSIYIAGLVFKWLKAQGGVGAIEQRNIA 295 ********************************************************************* PP TIGR01364 268 KakllYeaidesegfyknkvekkaRslmnvvFtlkkeelekeFlkeaeekglvslkGhrsvGGiRasiY 336 K++ lYe +d+s fy+n++++ +Rs+mnv+F l++e ++ Fl+ a+++glv+lkGh+svGG+Ras+Y lcl|FitnessBrowser__Cup4G11:RR42_RS04455 296 KSHALYEFLDQSA-FYRNEIDPGSRSRMNVPFFLADESRNDAFLAGARANGLVQLKGHKSVGGMRASLY 363 **********996.******************************************************* PP TIGR01364 337 nalpleevqaLvdfmkeFek 356 na+p+e+v aL+++m+eFe+ lcl|FitnessBrowser__Cup4G11:RR42_RS04455 364 NAMPIEGVAALIEYMREFER 383 ******************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (358 nodes) Target sequences: 1 (386 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.65 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory