Align Histidinol-phosphatase [alternative form] (EC 3.1.3.15) (characterized)
to candidate SMc04042 SMc04042 monophosphatase
Query= reanno::Phaeo:GFF2154 (250 letters) >FitnessBrowser__Smeli:SMc04042 Length = 259 Score = 234 bits (596), Expect = 2e-66 Identities = 121/247 (48%), Positives = 157/247 (63%), Gaps = 1/247 (0%) Query: 1 MADAARQAILPYFRSAGLQSDNKLDEGFDPVTIADRAAEQAMRSVLSELRPEDSILGEEF 60 +ADAA+ +P FR G NKL+ GFDPVT ADR+AE ++R+++ PE ILGEE Sbjct: 11 LADAAKAETMPRFR-VGTSVLNKLEGGFDPVTEADRSAEASIRALIESSFPEHGILGEEH 69 Query: 61 GETHGQSGRTWVLDPIDGTRGFISGTPTWGVLIALGDADGPFLGIVDQPYIGERFIGTPE 120 G WV+DPIDGTR FISG P WG LI L +G++DQP+ GERF E Sbjct: 70 GNIGLDRELVWVIDPIDGTRAFISGLPVWGTLIGLYRNGKAVMGLMDQPFTGERFFADGE 129 Query: 121 GASLTGPLGHSALVTRATDSLSEATLFTTFPEVGTEAERAAFQRVSAQVRLTRYGMDCYA 180 A GP G L TR +LS+A LFTT P + T + F+ + +VRL RYG DCYA Sbjct: 130 KALYRGPDGERVLATRPCHALSDAVLFTTSPHLYTGELKERFEALQEKVRLFRYGCDCYA 189 Query: 181 YALLAAGQCDLVIEAGLNAYDIQAPIAVIQAAGGVVTNWQGEPAHEGGQVLAAATAELHA 240 +ALLAAG DLV+E GL YD+ I +I+ AGG++T+WQG PA GG+++AA + ELHA Sbjct: 190 FALLAAGHVDLVVECGLKPYDVGGLIPLIEQAGGIITDWQGGPAEMGGEIIAAGSRELHA 249 Query: 241 AALALIQ 247 AL ++ Sbjct: 250 QALEALK 256 Lambda K H 0.317 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 222 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 259 Length adjustment: 24 Effective length of query: 226 Effective length of database: 235 Effective search space: 53110 Effective search space used: 53110 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate SMc04042 SMc04042 (monophosphatase)
to HMM TIGR02067 (hisN: histidinol-phosphatase (EC 3.1.3.15))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR02067.hmm # target sequence database: /tmp/gapView.28531.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02067 [M=252] Accession: TIGR02067 Description: his_9_HisN: histidinol-phosphatase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-102 327.8 0.0 2.5e-102 327.7 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc04042 SMc04042 monophosphatase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc04042 SMc04042 monophosphatase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 327.7 0.0 2.5e-102 2.5e-102 2 252 .] 5 256 .. 4 256 .. 0.98 Alignments for each domain: == domain 1 score: 327.7 bits; conditional E-value: 2.5e-102 TIGR02067 2 lalalelaeaageailkyfrasdlkvdkksdk.tpVteADraaEeaireliaakfPddgilGEEfgeeeedaeyv 75 ++++++la+aa+++++++fr +++ +k + +pVteADr+aE+ ir+li+++fP++gilGEE+g++ d+e v lcl|FitnessBrowser__Smeli:SMc04042 5 RTFFDRLADAAKAETMPRFRVGTSVLNKLEGGfDPVTEADRSAEASIRALIESSFPEHGILGEEHGNIGLDRELV 79 6899************************99999****************************************** PP TIGR02067 76 WvlDPiDGTksFirGvPvwgtLiaLlekgkpvlGvisqPalgerfvaakgegallng.gerelrvsevaklsdAv 149 Wv+DPiDGT++Fi+G+PvwgtLi+L+++gk+v+G+++qP++gerf+a+ +++ ++ + ger l+++ +++lsdAv lcl|FitnessBrowser__Smeli:SMc04042 80 WVIDPIDGTRAFISGLPVWGTLIGLYRNGKAVMGLMDQPFTGERFFADGEKALYRGPdGERVLATRPCHALSDAV 154 *******************************************************98667*************** PP TIGR02067 150 lvttspkaledeeereafeklrrkarltryggdcyayalvAsGrvdlvveaelspyDiaalipiieeAggvitdw 224 l+ttsp +l + e +e+fe+l++k+rl ryg+dcya+al+A+G+vdlvve++l+pyD+ lip+ie+Agg+itdw lcl|FitnessBrowser__Smeli:SMc04042 155 LFTTSP-HLYTGELKERFEALQEKVRLFRYGCDCYAFALLAAGHVDLVVECGLKPYDVGGLIPLIEQAGGIITDW 228 ******.9******************************************************************* PP TIGR02067 225 kGkeaeeggeavaaanaalhdevlellk 252 +G +ae+gge++aa++++lh+++le+lk lcl|FitnessBrowser__Smeli:SMc04042 229 QGGPAEMGGEIIAAGSRELHAQALEALK 256 *************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (252 nodes) Target sequences: 1 (259 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 7.88 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory