Align homoisocitrate dehydrogenase (EC 1.1.1.87) (characterized)
to candidate WP_002721052.1 RSPH17029_RS12705 3-isopropylmalate dehydrogenase
Query= BRENDA::Q5SIJ1 (334 letters) >NCBI__GCF_000015985.1:WP_002721052.1 Length = 369 Score = 180 bits (457), Expect = 4e-50 Identities = 136/363 (37%), Positives = 191/363 (52%), Gaps = 39/363 (10%) Query: 5 ICLIEGDGIGHEVIPAARRVL----EATGLPLEFVEAEAGWETFERRGTSVPEETVEKIL 60 + ++ GDGIG EV+ +R++ E G+ + E G ++ GT + +ET+ + Sbjct: 6 LLILAGDGIGPEVMAEVKRIIGWFGEKRGVTFDVSEDLVGGAAYDAHGTPLADETMARAQ 65 Query: 61 SCHATLFGAATSPTRKVPGFF-----GAIRYLRRRLDLYANVRPAK--------SRPVPG 107 A L GA P V F G +R LR+ +DLYAN+RPA+ S Sbjct: 66 EVDAVLLGAVGGPKYDVLDFSVKPERGLLR-LRKEMDLYANLRPAQCFDALADFSSLKRD 124 Query: 108 SRPGVDLVIVRENTEGLYVEQERRYLD------VAIADAVISKKASERIGRAALRIAEGR 161 G+D++IVRE T G+Y + R + + + R+ R+A +A R Sbjct: 125 IVAGLDIMIVRELTSGVYFGEPRGIFPDNEGGRFGVNTQRYTTEEIRRVARSAFELARRR 184 Query: 162 PRKTLHIAHKANVLPLTQGLFLDTVKEVA-KDFPLVNVQDIIVDNCAMQLVMRPERFDVI 220 + + KANV+ + L+ + V+ V ++P V + + DN AMQLV P +FDVI Sbjct: 185 NNRVCSM-EKANVME-SGILWREEVQWVHDNEYPDVELSHMYADNGAMQLVRWPRQFDVI 242 Query: 221 VTTNLLGDILSDLAAGLVGGLGLAPSGNI------GDTTAVFEPVHGSAPDIAGKGIANP 274 VT NL GDILSD AA L G LG+ PS ++ G A++EPVHGSAPDIAG+G ANP Sbjct: 243 VTDNLFGDILSDCAAMLTGSLGMLPSASLGAPMANGRPKALYEPVHGSAPDIAGQGKANP 302 Query: 275 TAAILSAAMMLDYLGEK-EAAKRVEKAVDLVLERGPRTPDL-----GGDATTEAFTEAVV 328 A ILS AM L Y + E A R+EKAV+ VL G RT DL G +T +AV+ Sbjct: 303 IACILSFAMALRYSFDMGEEATRLEKAVETVLADGVRTADLMGPEGGTPVSTSGMGDAVL 362 Query: 329 EAL 331 AL Sbjct: 363 AAL 365 Lambda K H 0.319 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 20 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 369 Length adjustment: 29 Effective length of query: 305 Effective length of database: 340 Effective search space: 103700 Effective search space used: 103700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory