Align Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 (uncharacterized)
to candidate WP_002721320.1 RSPH17029_RS13430 aspartate carbamoyltransferase catalytic subunit
Query= curated2:Q8DVC9 (326 letters) >NCBI__GCF_000015985.1:WP_002721320.1 Length = 320 Score = 72.8 bits (177), Expect = 1e-17 Identities = 58/178 (32%), Positives = 88/178 (49%), Gaps = 4/178 (2%) Query: 17 EIEDFIDLAMQFKKLKKERIPHR-YFDGLNIALIFEKTSTRTRSAFTVAGQDLGMNVSYL 75 EI +DLA + L + + G+ +F + STRT+S+F +AG+ LG +V + Sbjct: 18 EIRSVLDLADSYVDLNRRTMKQSDALAGMTQINMFFENSTRTQSSFELAGKRLGADVMNM 77 Query: 76 GKDDIQLGKKESLVDTAKVLGTMF-DGIEYRGFKQESVELLAEFSGVPVWN-GLTDTWHP 133 + K E+L+DTA L M D + R +V LLA V N G HP Sbjct: 78 AVAQSSVKKGETLLDTAMTLNAMHPDLLVVRHPASGAVNLLASKVNCAVLNAGDGRHEHP 137 Query: 134 TQMIADFMTVKEHFGKFEDLTLAYLGD-GRNNVANSLLVTSAILGINVKIIAPKELQP 190 TQ + D +T++ G+ + LT+A GD + VA S L+ + V++IAP L P Sbjct: 138 TQALLDALTIRRAKGRIQRLTVAICGDIAHSRVARSNLILLGKMENRVRLIAPPTLMP 195 Lambda K H 0.319 0.136 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 320 Length adjustment: 28 Effective length of query: 298 Effective length of database: 292 Effective search space: 87016 Effective search space used: 87016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 16 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory