Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_004299037.1 C665_RS02135 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_000310185.1:WP_004299037.1 Length = 355 Score = 373 bits (958), Expect = e-108 Identities = 186/362 (51%), Positives = 250/362 (69%), Gaps = 8/362 (2%) Query: 4 ADQLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVLKH 63 +D+L LR ID +DE IL ++ERARCAQ V +K ++YRPEREA VL+ Sbjct: 2 SDELLKLRNEIDRIDEEILARLAERARCAQRVGEIKRG-------VMYYRPEREAQVLRR 54 Query: 64 IMELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISKP 123 + ELN GPL ++ + +FRE+MS+CL LEQPLRVAYLGP GTFS++A+ KHFG + P Sbjct: 55 LAELNPGPLSSDAVKTIFREVMSACLGLEQPLRVAYLGPAGTFSESASRKHFGSAPNFLP 114 Query: 124 MAAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVG 183 MAAID+VFR V AG ++GVVPVENSTEGAV TLD L + + +CGEV LRIH L+ Sbjct: 115 MAAIDDVFRAVEAGNADYGVVPVENSTEGAVGGTLDLLLANPLKVCGEVRLRIHQQLM-S 173 Query: 184 ETTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDM 243 RIYSHAQSLAQC +WL+ + P++ R+ V+SNA+AA+ + S AIAGD Sbjct: 174 RAEGIGAARRIYSHAQSLAQCHEWLNRNLPHLPRIPVASNAEAARMASEDPESCAIAGDA 233 Query: 244 AAQLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELLMPF 303 AAQLYGL+ LA IED P N+TRFL+I + P+G D+TS++ S N+PGA+H LL P Sbjct: 234 AAQLYGLNILAPNIEDDPNNTTRFLVIADHDAGPSGKDRTSLVFSAPNRPGAIHSLLEPM 293 Query: 304 HSNGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYPKA 363 +G+D+T++++RP+RSG W YVF+ D GH +DP + L ++ A +K++GSYP A Sbjct: 294 ARHGVDMTKLQSRPARSGLWEYVFYADINGHREDPEVAAALRELDERAAFVKIIGSYPVA 353 Query: 364 VL 365 + Sbjct: 354 AI 355 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 355 Length adjustment: 29 Effective length of query: 336 Effective length of database: 326 Effective search space: 109536 Effective search space used: 109536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_004299037.1 C665_RS02135 (prephenate dehydratase)
to HMM TIGR01807 (pheA: chorismate mutase (EC 5.4.99.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01807.hmm # target sequence database: /tmp/gapView.18718.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01807 [M=76] Accession: TIGR01807 Description: CM_P2: chorismate mutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-29 88.5 1.2 1.4e-29 88.5 1.2 2.4 3 lcl|NCBI__GCF_000310185.1:WP_004299037.1 C665_RS02135 prephenate dehydrat Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000310185.1:WP_004299037.1 C665_RS02135 prephenate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 88.5 1.2 1.4e-29 1.4e-29 1 76 [] 5 76 .. 5 76 .. 0.98 2 ? -2.4 0.0 0.33 0.33 14 26 .. 166 178 .. 163 191 .. 0.69 3 ? -2.3 0.0 0.29 0.29 17 30 .. 335 348 .. 331 350 .. 0.81 Alignments for each domain: == domain 1 score: 88.5 bits; conditional E-value: 1.4e-29 TIGR01807 1 LkelRnkiDaiDdrildLlseRaklakavgelKkksaseaviYRPeREaavlrrlkelnkGpLdqeavari 71 L +lRn+iD iD++il l eRa++a++vge+K+ + YRPeREa+vlrrl eln+GpL ++av+ i lcl|NCBI__GCF_000310185.1:WP_004299037.1 5 LLKLRNEIDRIDEEILARLAERARCAQRVGEIKRG----VMYYRPEREAQVLRRLAELNPGPLSSDAVKTI 71 678******************************98....899***************************** PP TIGR01807 72 frEim 76 frE+m lcl|NCBI__GCF_000310185.1:WP_004299037.1 72 FREVM 76 ****9 PP == domain 2 score: -2.4 bits; conditional E-value: 0.33 TIGR01807 14 rildLlseRakla 26 ri++ l+ Ra+ + lcl|NCBI__GCF_000310185.1:WP_004299037.1 166 RIHQQLMSRAEGI 178 6777777777654 PP == domain 3 score: -2.3 bits; conditional E-value: 0.29 TIGR01807 17 dLlseRaklakavg 30 + l eRa ++k +g lcl|NCBI__GCF_000310185.1:WP_004299037.1 335 RELDERAAFVKIIG 348 56899**9999998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (76 nodes) Target sequences: 1 (355 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 8.45 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory