Align Prephenate dehydrogenase protein; EC 1.3.1.12 (characterized, see rationale)
to candidate WP_004299043.1 C665_RS02145 prephenate dehydrogenase/arogenate dehydrogenase family protein
Query= uniprot:D8IR44_HERSS (295 letters) >NCBI__GCF_000310185.1:WP_004299043.1 Length = 295 Score = 340 bits (873), Expect = 2e-98 Identities = 174/284 (61%), Positives = 210/284 (73%) Query: 4 KVVIFGVGLIGGSFALALRRAGQAAHIVGVGRSLQSLERARELGIIDAVATDAASAVQGA 63 K+V+ GVGLIGGSFALALRRAG IVG+GR + LERA LG+ID +A A A+ GA Sbjct: 6 KLVVCGVGLIGGSFALALRRAGAVERIVGIGRRREVLERACALGVIDEIAEGWADALDGA 65 Query: 64 DLILVAAPVAQTGPILASIAPHLEPQAIVTDAGSTKSDVVAAARMALGDRIVQFIPAHPI 123 DL+L+AAPV QT ILA++APHL P IVTDAGSTK DVVAA R LG + +PAHPI Sbjct: 66 DLVLLAAPVGQTDAILAAMAPHLRPGTIVTDAGSTKRDVVAALRTHLGGALADVVPAHPI 125 Query: 124 AGREKHGPEAALAELYEGKKVVITALPENDAADVEIVAAAWRACGAVIHRLSPQEHDAVF 183 AG EK G EAA AELY G+KVV+T LPE+ V+ V AW ACGA + ++PQEHD VF Sbjct: 126 AGAEKSGVEAAFAELYMGRKVVLTPLPESRPEAVQKVRDAWEACGANVVGMTPQEHDRVF 185 Query: 184 ASVSHLPHVLAFALVDDIAAKPHAATLFQYAASGFRDFTRIAASSPEMWRDITLANRDAL 243 A+VSHLPH+LAF LVDD+A + +A LF +AASGFRDFTRIA S PEMWRDI +ANR AL Sbjct: 186 AAVSHLPHLLAFGLVDDLAGRSNAPLLFSHAASGFRDFTRIAGSHPEMWRDICVANRVAL 245 Query: 244 LTEVDAYLLQLQNIRAMIAAGDGPGIEKIYASAQHARQQWAAAI 287 L E+DAYL +L +R M+ GDG G+E ++ A+HAR WA + Sbjct: 246 LEELDAYLGELARLRMMLVEGDGDGLEAVFERARHARNAWAEGL 289 Lambda K H 0.320 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 296 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 295 Length adjustment: 26 Effective length of query: 269 Effective length of database: 269 Effective search space: 72361 Effective search space used: 72361 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory