Align homoserine dehydrogenase (EC 1.1.1.3); aspartate kinase (EC 2.7.2.4) (characterized)
to candidate WP_004304068.1 C665_RS07165 homoserine dehydrogenase
Query= BRENDA::Q9WZ17 (739 letters) >NCBI__GCF_000310185.1:WP_004304068.1 Length = 435 Score = 207 bits (527), Expect = 9e-58 Identities = 126/319 (39%), Positives = 188/319 (58%), Gaps = 7/319 (2%) Query: 17 VRKVRVGIAGLGTVGGSIYRILKERGNEIEKRIGEKFIISKVINRSPQKYELLGVPKEEI 76 ++ + VG+ G+GTVGG Y +LK EI +R G I V +++ + + + ++ Sbjct: 1 MKPINVGLLGIGTVGGGTYTVLKRNAEEITRRAGRPIRIVTVADKNLELARKVTGGEVKL 60 Query: 77 AFDFDDLILNS--DVVVEAIGGTDVAVDLVRRALELGRIVVTPNKNLISEYGNEFSEYIK 134 D ++ + D+VVE IGG VA +LV +A+E G+ VVT NK L++ +GNE + Sbjct: 61 TDDAFSVVTDPGIDIVVELIGGYGVARELVLKAIENGKHVVTANKALLAVHGNEIFAAAQ 120 Query: 135 KRKLF--FEASVGGGIPIISLLQDYLIFQKVTRIRGIMNGTTNYILTEM-SKGRHFEEVL 191 K+ + FEA+V GGIPII L++ L ++ + GI+NGTTN+IL+EM KG F EVL Sbjct: 121 KKGVMVAFEAAVAGGIPIIKALREGLTANRIEWLAGIINGTTNFILSEMRDKGLPFAEVL 180 Query: 192 KEAQELGYAEADPTNDIEGYDVAYKVSVLAGVVTGRFPGINSVQFEGITRIDPEYLKEIV 251 KEAQ LGYAEADPT D+EG D A+K ++++ + G + EGI+++D + Sbjct: 181 KEAQALGYAEADPTFDVEGVDAAHKATIMSAIAFGIPMQFDKAYIEGISKLDSVDIGYAE 240 Query: 252 RSGKKLKLIGELDFSTNRYEVRLRE--VTPEDPFFNVDGVDNAIEVSTDLAGDFLLKGRG 309 + G ++KL+G N E+R+ + + NV+G NA+ V D G L G+G Sbjct: 241 QLGYRIKLLGIARRRENGVELRVHPTLIPAKRLIANVEGAMNAVLVQGDAVGATLYYGKG 300 Query: 310 AGGYPTASAVIADLFRVAK 328 AG PTASAVIADL V + Sbjct: 301 AGAEPTASAVIADLVDVTR 319 Score = 31.6 bits (70), Expect = 9e-05 Identities = 17/37 (45%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Query: 605 VPDKPGVAARIMRTLSQMGVNIDMIIQGMKS-GEYNT 640 V DKPGV A I R L+ G++I+ +IQ + GE +T Sbjct: 360 VEDKPGVLADITRILADSGISIEALIQKQAAEGEAHT 396 Lambda K H 0.318 0.137 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 799 Number of extensions: 46 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 739 Length of database: 435 Length adjustment: 36 Effective length of query: 703 Effective length of database: 399 Effective search space: 280497 Effective search space used: 280497 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory