Align histidinol-phosphatase (EC 3.1.3.15); inositol-phosphate phosphatase (EC 3.1.3.25) (characterized)
to candidate WP_004308207.1 C665_RS10405 inositol monophosphatase
Query= BRENDA::G7J7Q5 (326 letters) >NCBI__GCF_000310185.1:WP_004308207.1 Length = 266 Score = 97.8 bits (242), Expect = 3e-25 Identities = 79/266 (29%), Positives = 128/266 (48%), Gaps = 22/266 (8%) Query: 68 DVANKAANAAGDVIRKYFRKNNFDIIHKNDLSP---VTIADQSAEEAMVSVILDNFPSHA 124 ++A KAA A VI + D++ SP VT D++AE+A++ V+ D FP H Sbjct: 6 NIAVKAARRAASVINR--ASTQLDLLTVQSKSPNDFVTEVDRAAEQAIIEVLRDAFPGHG 63 Query: 125 VYGEEKGWRCKQDSADYVWVLDPIDGTKSFITGKPLFGTLIALLQNGTPILGIIDQPVLK 184 + EE G + ++Y W++DP+DGT +FI G P + IA +NG ++ P Sbjct: 64 ILAEESGESGPE--SEYTWIIDPLDGTTNFIHGMPQYAVSIAQAKNGVLEHAVVYDPNTN 121 Query: 185 ERWIGITGKRTTLNGQEVSTRTCADLSQAYLYTTSPHLFSGDAEEAFIRV-----RDKVK 239 E + G LN + + L++A + T P D +A++ + + Sbjct: 122 EMFTASRGAGAFLNDRRIRVSRRTRLNEALIGTGFP-FRQFDHVDAYLAMFKELTQKTAG 180 Query: 240 IPLYGCDCYAYALLSSGFVDLVVESGLKPYDFLALIPVIEGSGGVITDWKGHQLRWEASP 299 I G A ++SG D E GL P+D A + +I+ +GG+++D G EA+ Sbjct: 181 IRRPGAASLDLAYVASGRFDGFWEMGLSPWDMAAGVLLIQEAGGLVSDLSG-----EANY 235 Query: 300 LSIATSFNVVAAGDKQIHQQALDSLQ 325 L T+ N+V AG +I Q L +Q Sbjct: 236 L---TTGNLV-AGTPKIFGQLLPIIQ 257 Lambda K H 0.319 0.135 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 266 Length adjustment: 26 Effective length of query: 300 Effective length of database: 240 Effective search space: 72000 Effective search space used: 72000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory