Align Histidinol-phosphatase [alternative form] (EC 3.1.3.15) (characterized)
to candidate WP_004320146.1 C665_RS14935 3'(2'),5'-bisphosphate nucleotidase
Query= reanno::Korea:Ga0059261_2035 (260 letters) >NCBI__GCF_000310185.1:WP_004320146.1 Length = 256 Score = 96.3 bits (238), Expect = 6e-25 Identities = 78/239 (32%), Positives = 107/239 (44%), Gaps = 31/239 (12%) Query: 17 AAGAAIRPYFRAEHGLESKDDSSPVTLADKAAEAAMRRLIIAERPMDAIIGEEE---DDR 73 AAGA + +R++ + KDD+SPVT AD+ AEA + + A P ++ EE Sbjct: 19 AAGALVMDIYRSDFAVRGKDDASPVTEADERAEALIVPALEALLPGVPVVAEEAVAAGRL 78 Query: 74 PGTSGRIWVLDPIDGTRSFIVGRPIFGTLIALLEDGWPVLGIIDQPIIKERWLGVTG--- 130 P R W++DP+DGT+ FI F IAL+EDG PVLG + P ++ +LG G Sbjct: 79 PALGRRFWLVDPLDGTKEFIGRNGEFTVNIALVEDGEPVLGTVFAPALERLFLGAGGVGA 138 Query: 131 -RETLFNGKPARARTCRELSKALLATTSPALFTDGQLHAFEHVDAAVMSTVL-------- 181 E +P R RT ++A+ S H DAA + L Sbjct: 139 FVEQDGRRRPIRCRTVPPAGLTVVASRS-------------HGDAAALDAFLDGRKVAAL 185 Query: 182 --GGDCYNYGLVASGHLDIVIEAGLKLH-DFAALVPVVEGAGGRMCDWQGDPLHAGSNG 237 G LVA+G D G + D AA V+ AGGR+ G PL G G Sbjct: 186 TNAGSSLKLCLVAAGEADRYPRLGRTMEWDIAAGHAVLTAAGGRVQTLAGAPLRYGKPG 244 Lambda K H 0.320 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 256 Length adjustment: 24 Effective length of query: 236 Effective length of database: 232 Effective search space: 54752 Effective search space used: 54752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory