Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate WP_004326947.1 C665_RS18805 3-phosphoserine/phosphohydroxythreonine transaminase
Query= BRENDA::P23721 (362 letters) >NCBI__GCF_000310185.1:WP_004326947.1 Length = 363 Score = 305 bits (781), Expect = 1e-87 Identities = 167/362 (46%), Positives = 222/362 (61%), Gaps = 3/362 (0%) Query: 2 AQIFNFSSGPAMLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDLL 61 A +NF++GPA LP VL++A+ L G S +E G +F A + LL Sbjct: 4 ATAWNFAAGPARLPDAVLERARDGLFVRGAEGASALERPFTGADFRATLSRARERLAQLL 63 Query: 62 NVPSNYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYWAASAIKEAKKYCTPNVFDA 121 +P+NY++LF GG QFA VP+N+LG A Y D+GYWA AI EA++YC V Sbjct: 64 ELPANYRILFLAGGAMQQFALVPMNLLGHARRAAYADSGYWAQRAIAEARRYCEV-VAAP 122 Query: 122 KVTVDGLRAVKPMREWQLSDNAAYMHYCPNETIDGIAIDETPDFGADVVVAADFSSTILS 181 D A P W L + AY H PNET+DG+A PD G +V + AD +S +L+ Sbjct: 123 GFPGDVPLAAPPAGRWDLPADCAYCHITPNETVDGLAYPALPDTG-EVPLVADATSCLLT 181 Query: 182 RPIDVSRYGVIYAGAQKNIGPAGLTIVIVREDLLGKANIACPSILDYSILNDNGSMFNTP 241 P+D++R+G++YA AQKN+G AGL +++VREDLL +A A P+ L Y + S NTP Sbjct: 182 APLDLARFGLLYASAQKNLGVAGLCVLVVREDLLERAAPAVPAALSYRRQAEADSCLNTP 241 Query: 242 PTFAWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNS-DFYRNDVAKANRSRMNV 300 PT A +L+GLVF W+ +GG+A M N++KA LY ID S FYR VA A+RS +NV Sbjct: 242 PTLAIHLAGLVFDWIAESGGLAAMGAANRRKAATLYAAIDGSGGFYRAPVAVAHRSPVNV 301 Query: 301 PFQLADSALDKLFLEESFAAGLHALKGHRVVGGMRASIYNAMPLEGVKALTDFMVEFERR 360 F LAD AL + FL + + GLH L+GHR VGG+RAS+YNAMP G AL FM +F RR Sbjct: 302 RFHLADDALTEPFLAAAASRGLHNLRGHRQVGGLRASLYNAMPQAGADALAGFMADFARR 361 Query: 361 HG 362 G Sbjct: 362 RG 363 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 352 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 363 Length adjustment: 29 Effective length of query: 333 Effective length of database: 334 Effective search space: 111222 Effective search space used: 111222 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory