Align L-serine/homoserine O-acetyltransferase; Homoserine O-trans-acetylase; EC 2.3.1.30; EC 2.3.1.31 (characterized)
to candidate WP_004511679.1 GMET_RS13945 homoserine O-acetyltransferase
Query= SwissProt::D2Z028 (374 letters) >NCBI__GCF_000012925.1:WP_004511679.1 Length = 369 Score = 237 bits (605), Expect = 3e-67 Identities = 141/355 (39%), Positives = 205/355 (57%), Gaps = 15/355 (4%) Query: 20 MRRGGALYGARIAYETFGSLNAARDNAVLVLTGLSPDAHAASR--PDDPTPGWWEAMVGP 77 + G L +AYET+G LNA R NA+LV + +AH A + +D PGWW+A+VGP Sbjct: 19 LESGRILGPITLAYETYGELNADRSNAILVAHAWTGNAHLAGKNSEEDTKPGWWDAIVGP 78 Query: 78 GKPVDTDLWHVICVNSLGSCKGSTGPASTDPRTGEPYRLSFPELSIEDIADAAAHTVRAL 137 G+ +DTD VIC N +GSC GSTGPAS +P+TG+ Y L+FP +++ D+ A A + L Sbjct: 79 GRLLDTDRCFVICSNVIGSCYGSTGPASINPKTGKRYNLTFPVITVRDMVRAQALLLDHL 138 Query: 138 GISRLACVVGASMGGMSALALLARHPELARTHISLSGAVHALPFSIAVRSLQREAIRSDP 197 GI RL V+G SMGGM AL + P+ R+ I+L+ P +I++ ++ R AI +DP Sbjct: 139 GIDRLLTVLGGSMGGMQALEWATQFPDRIRSAIALATTSRPSPQAISLNAVARWAIFNDP 198 Query: 198 GWLQGHYDEGEGPRRGMLTARKLGMMTYRSAQEWDCRFGRTRIGERRRADQGRFG--PEF 255 W +G Y + P+ G+ AR +G +T+ S + +FGR R A G F +F Sbjct: 199 TWKKGEY--RKNPKDGLALARGIGHITFLSDESMWQKFGR-----RFNARDGLFDFFGQF 251 Query: 256 EVESYLDFHAQRFADRFDPNSYLYLSHAMDQFDLGDGGGGGGGAPGALSRMRVERALVMG 315 EVE YL ++ F DRFD NS+LYL+ A+D +D G A SR++ Sbjct: 252 EVERYLSYNGYNFVDRFDTNSFLYLAKALDLYDT---AWGYESLEEAFSRVKAP-IQFFA 307 Query: 316 ARTDILFPLSQQQEIADGLSAGGADVSFLPVDTPAGHDAFLVDIERFGPPVAKFL 370 +D L+P Q +E+A L + G V + +++ GHDAFL++ E F P V +FL Sbjct: 308 FTSDWLYPPYQTEEMATILRSLGKPVEYHLIESAYGHDAFLLEHETFAPMVREFL 362 Lambda K H 0.321 0.138 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 369 Length adjustment: 30 Effective length of query: 344 Effective length of database: 339 Effective search space: 116616 Effective search space used: 116616 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory