GapMind for Amino acid biosynthesis

 

Alignments for a candidate for cmutase in Geobacter metallireducens GS-15

Align Chorismate mutase; CM; Monofunctional chorismate mutase AroQ(f); EC 5.4.99.5 (characterized)
to candidate WP_004511889.1 GMET_RS09875 chorismate mutase

Query= SwissProt::Q57696
         (99 letters)



>NCBI__GCF_000012925.1:WP_004511889.1
          Length = 98

 Score = 60.8 bits (146), Expect = 4e-15
 Identities = 30/94 (31%), Positives = 62/94 (65%), Gaps = 3/94 (3%)

Query: 7  EIRKKIDEIDNKILKLIAERNSLAKDVAEIKNQLGIPINDPEREKYIYDRIRKLCKEHNV 66
          E+R++ID +D+++L++   R SLA ++  IK + G+P+ DP+REK I++R+ K      +
Sbjct: 5  ELRQEIDRMDSELLRIFNRRASLALEIGLIKKERGLPVYDPKREKLIFERM-KADNPGPL 63

Query: 67 DENIGIKIFQILIEHNKALQK--QYLEETQNKNK 98
          D+   +++F+ +I+ ++ L++   + EET  K +
Sbjct: 64 DDGAIVRLFERVIDESRRLERIMTHPEETTGKEE 97


Lambda     K      H
   0.315    0.136    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 36
Number of extensions: 4
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 99
Length of database: 98
Length adjustment: 10
Effective length of query: 89
Effective length of database: 88
Effective search space:     7832
Effective search space used:     7832
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.6 bits)
S2: 39 (19.6 bits)

Align candidate WP_004511889.1 GMET_RS09875 (chorismate mutase)
to HMM PF01817 (CM_2)

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/PF01817.25.hmm
# target sequence database:        /tmp/gapView.16566.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       CM_2  [M=79]
Accession:   PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
      6e-27   80.2   0.9      7e-27   80.0   0.9    1.1  1  lcl|NCBI__GCF_000012925.1:WP_004511889.1  GMET_RS09875 chorismate mutase


Domain annotation for each sequence (and alignments):
>> lcl|NCBI__GCF_000012925.1:WP_004511889.1  GMET_RS09875 chorismate mutase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   80.0   0.9     7e-27     7e-27       1      78 [.       7      83 ..       7      84 .. 0.97

  Alignments for each domain:
  == domain 1  score: 80.0 bits;  conditional E-value: 7e-27
                                      CM_2  1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlre...gaeelgldpeavekifr 68
                                              R+eId++D+ell+++++R++la ei+ +Kke+glpv+dp+Re+ ++er+++   g+    ld+ a+ ++f+
  lcl|NCBI__GCF_000012925.1:WP_004511889.1  7 RQEIDRMDSELLRIFNRRASLALEIGLIKKERGLPVYDPKREKLIFERMKAdnpGP----LDDGAIVRLFE 73
                                              9**************************************************97777....*********** PP

                                      CM_2 69 eiisesralQ 78
                                              ++i+esr+l+
  lcl|NCBI__GCF_000012925.1:WP_004511889.1 74 RVIDESRRLE 83
                                              ********99 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (79 nodes)
Target sequences:                          1  (98 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 4.07
//
[ok]

This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory