Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_004513008.1 GMET_RS04315 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_000012925.1:WP_004513008.1 Length = 355 Score = 305 bits (782), Expect = 9e-88 Identities = 156/357 (43%), Positives = 233/357 (65%), Gaps = 6/357 (1%) Query: 7 LKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVLKHIME 66 L+ LR ID++D++ILDL++ R+R A EV +VK E F+ P RE + + + Sbjct: 4 LQELRRDIDAIDDQILDLLNSRSRLAIEVGKVKAG-----ENRDFHVPSREREIYERLAA 58 Query: 67 LNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISKPMAA 126 N GP NE + +FREI+S+ LALE P++VA+LGP+ TF+ A+L+HFG S P + Sbjct: 59 GNSGPFPNEAVRSVFREIISASLALESPMKVAFLGPKATFTHLASLQHFGLSAELVPQKS 118 Query: 127 IDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGETT 186 I VF EV G +GVVPVENSTEG V+HTLD F+E D+ I E+ L + H LL T Sbjct: 119 IPAVFEEVSKGRSLYGVVPVENSTEGMVSHTLDMFMESDLKINAEILLEVSHDLL-SRTG 177 Query: 187 KTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAAQ 246 + + + ++YSH Q++AQCR WLD + V V V+S A AA+ V ++ +AAIA + AA Sbjct: 178 RLEDVKKVYSHPQAIAQCRNWLDENLSGVPVVDVASTALAAQIVGEDYTAAAIASEFAAA 237 Query: 247 LYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELLMPFHSN 306 LY L + +IED+ N TRFL++G + GDDKTS++ S++++PG LH +L PF Sbjct: 238 LYDLKVVRHRIEDQVNNFTRFLVVGRKMADRCGDDKTSLMFSVKDEPGILHRMLEPFAKR 297 Query: 307 GIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYPKA 363 G++L++IE+RP + W Y+FF+D GH DP++ + ++++ + +K+LGSYP+A Sbjct: 298 GVNLSKIESRPLKKKAWEYIFFLDLAGHISDPVVSDAVQELKNYCQFVKILGSYPRA 354 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 355 Length adjustment: 29 Effective length of query: 336 Effective length of database: 326 Effective search space: 109536 Effective search space used: 109536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_004513008.1 GMET_RS04315 (prephenate dehydratase)
to HMM TIGR01807 (pheA: chorismate mutase (EC 5.4.99.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01807.hmm # target sequence database: /tmp/gapView.29844.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01807 [M=76] Accession: TIGR01807 Description: CM_P2: chorismate mutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-25 75.6 0.6 3.9e-25 74.3 0.3 1.9 2 lcl|NCBI__GCF_000012925.1:WP_004513008.1 GMET_RS04315 prephenate dehydrat Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000012925.1:WP_004513008.1 GMET_RS04315 prephenate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 74.3 0.3 3.9e-25 3.9e-25 1 76 [] 4 77 .. 4 77 .. 0.98 2 ? -3.1 0.0 0.52 0.52 63 75 .. 114 126 .. 109 126 .. 0.85 Alignments for each domain: == domain 1 score: 74.3 bits; conditional E-value: 3.9e-25 TIGR01807 1 LkelRnkiDaiDdrildLlseRaklakavgelKkksaseaviYRPeREaavlrrlkelnkGpLdqeavari 71 L+elR iDaiDd+ildLl+ R +la +vg++K ++ ++ P RE+ + rl n Gp ++eav + lcl|NCBI__GCF_000012925.1:WP_004513008.1 4 LQELRRDIDAIDDQILDLLNSRSRLAIEVGKVKAG--ENRDFHVPSREREIYERLAAGNSGPFPNEAVRSV 72 799******************************99..899999**************************** PP TIGR01807 72 frEim 76 frEi+ lcl|NCBI__GCF_000012925.1:WP_004513008.1 73 FREII 77 ***97 PP == domain 2 score: -3.1 bits; conditional E-value: 0.52 TIGR01807 63 LdqeavarifrEi 75 ++q+++ ++f E+ lcl|NCBI__GCF_000012925.1:WP_004513008.1 114 VPQKSIPAVFEEV 126 6899999***997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (76 nodes) Target sequences: 1 (355 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 9.45 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory