Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54); chorismate mutase (EC 5.4.99.5) (characterized)
to candidate WP_004513790.1 GMET_RS00120 3-deoxy-7-phosphoheptulonate synthase
Query= BRENDA::P39912 (358 letters) >NCBI__GCF_000012925.1:WP_004513790.1 Length = 344 Score = 287 bits (734), Expect = 3e-82 Identities = 151/335 (45%), Positives = 223/335 (66%), Gaps = 11/335 (3%) Query: 20 ILKLINERG-NVVKEIGKAKEAQGVNRFD-PVRERTMLNNIIENNDGPFENSTIQHIFKE 77 ++ +I++ G ++ + KA E G+ P ERT + + N G +++TI+ + Sbjct: 2 LIVMIHKAGPKQIEAVVKAVETMGLTAAPIPGSERTAIG--VLGNKGYVDDTTIRDL--- 56 Query: 78 IFKAGLELQEEDHSKALLVSRKKKPEDTIVDIKGEKIGDGQQRFIV-GPCAVESYEQVAE 136 G++ LVSR P +TIV + G IG+G++ +V GPCAVE EQ+ + Sbjct: 57 ---PGVQEVIHVSKPYKLVSRDFHPRNTIVKVCGISIGEGKRPVVVAGPCAVEGEEQILK 113 Query: 137 VAAAAKKQGIKILRGGAFKPRTSPYDFQGLGVEGLQILKRVADEFDLAVISEIVTPAHIE 196 A A KK G +LRGGAFKPRT P+ FQG+ EGL++L + + L +++E+++P + Sbjct: 114 TARAVKKAGADLLRGGAFKPRTGPHTFQGMREEGLKLLAKAREATGLPIVTEVMSPDTVG 173 Query: 197 EALDYIDVIQIGARNMQNFELLKAAGAVKKPVLLKRGLAATISEFINAAEYIMSQGNDQI 256 +Y D++Q+GARNMQNFELLK G ++KPVLLKRG++ATI EF+ AAEYI+++GN + Sbjct: 174 LVAEYADLLQVGARNMQNFELLKELGRIQKPVLLKRGMSATIEEFLAAAEYILAEGNPHV 233 Query: 257 ILCERGIRTYETATRNTLDISAVPILKQETHLPVFVDVTHSTGRRDLLLPTAKAALAIGA 316 ILCERGIRT+ETATRNTLD++ VP++++ +HLPV VD +H+TG+R L+ P AKAAL GA Sbjct: 234 ILCERGIRTFETATRNTLDLAVVPLIREMSHLPVMVDPSHATGKRSLVAPMAKAALVAGA 293 Query: 317 DGVMAEVHPDPSVALSDSAQQMAIPEFEKWLNELK 351 GV+ EVHP+P ALSD Q + F+ + E++ Sbjct: 294 HGVLIEVHPEPDKALSDGPQSLTFHGFDLLMEEIR 328 Lambda K H 0.316 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 329 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 344 Length adjustment: 29 Effective length of query: 329 Effective length of database: 315 Effective search space: 103635 Effective search space used: 103635 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory