Align Cystathionine beta-lyase MetC; CBL; Beta-cystathionase MetC; Cysteine lyase MetC; Cysteine-S-conjugate beta-lyase MetC; EC 4.4.1.13 (characterized)
to candidate WP_004514090.1 GMET_RS03510 cystathionine gamma-synthase
Query= SwissProt::O31632 (390 letters) >NCBI__GCF_000012925.1:WP_004514090.1 Length = 378 Score = 444 bits (1141), Expect = e-129 Identities = 219/372 (58%), Positives = 279/372 (75%) Query: 10 TQLVHNPFKTDGGTGAVSVPIQHASTFHQSSFEEFGAYDYSRSGTPTRTALEETIAALEG 69 T+++H D TGAVS+PI STF Q S + FG YDY+RS PTR ALEETIA LEG Sbjct: 5 TRIIHTGHDIDPTTGAVSIPIYQTSTFRQESVDHFGKYDYARSDNPTREALEETIAQLEG 64 Query: 70 GTRGFAFSSGMAAISTAFLLLSQGDHVLVTEDVYGGTFRMVTEVLTRFGIEHTFVDMTDR 129 GTRGFA++SGMAAIS+ LL S GDH++V EDVYGGTFR++T++ +R GI TFVD TD Sbjct: 65 GTRGFAYASGMAAISSVLLLFSPGDHLVVCEDVYGGTFRVLTQLFSRLGITSTFVDATDL 124 Query: 130 NEVARSIKPNTKVIYMETPSNPTLGITDIKAVVQLAKENGCLTFLDNTFMTPALQRPLDL 189 + +A + +P TK +++E+PSNP L ITD++ ++A+E G +T +DNTFMTP LQRPL++ Sbjct: 125 DAIAAAFRPETKGLFLESPSNPLLKITDLEGAARIARERGAITLVDNTFMTPYLQRPLEV 184 Query: 190 GVDIVLHSATKFLSGHSDVLSGLAAVKDEELGKQLYKLQNAFGAVLGVQDCWLVLRGLKT 249 G DIVLHS TKFL+GHSDV+ G A VKD ELGK++ +QNAFGA+LG QD WLVLRGLKT Sbjct: 185 GCDIVLHSGTKFLNGHSDVICGFAVVKDPELGKRIRFIQNAFGAILGPQDSWLVLRGLKT 244 Query: 250 LQVRLEKASQTAQRLAEFFQKHPAVKRVYYPGLADHPGAETHKSQSTGAGAVLSFELESK 309 L+VR+E++ ++A R+A + V RV YPGL HPG H QS+G GAVLSF L+S Sbjct: 245 LRVRMEESQRSATRIASWLAGEKRVTRVLYPGLPSHPGHAIHARQSSGPGAVLSFALDSL 304 Query: 310 EAVKKLVENVSLPVFAVSLGAVESILSYPATMSHAAMPKEEREKRGITDGLLRLSVGVEH 369 E ++L+E + L FAVSLG VESI+SYPA MSHAAMP EER RGI D L+RLSVG+E Sbjct: 305 EVTRRLLEGMKLAAFAVSLGGVESIISYPARMSHAAMPPEERAARGIGDTLVRLSVGLEE 364 Query: 370 ADDLEHDFEQAL 381 ADDL + ++ + Sbjct: 365 ADDLIAEMDRLI 376 Lambda K H 0.317 0.132 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 438 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 390 Length of database: 378 Length adjustment: 30 Effective length of query: 360 Effective length of database: 348 Effective search space: 125280 Effective search space used: 125280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory