Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate WP_005452521.1 SACCYDRAFT_RS00330 cystathionine gamma-synthase
Query= BRENDA::Q5H4T8 (397 letters) >NCBI__GCF_000244975.1:WP_005452521.1 Length = 353 Score = 207 bits (528), Expect = 3e-58 Identities = 146/353 (41%), Positives = 189/353 (53%), Gaps = 35/353 (9%) Query: 49 SPGEHQGFEYSRTHN-PTRFAYERCVAALEGGTRAFAFASGMAATSTVMELLDAGSHVVA 107 +P G Y+R PT A+E + LEGGT A AFASG+A S V++ G+ VV Sbjct: 32 APASMLGLSYAREDGTPTWAAFEEALGELEGGT-ATAFASGIATASAVLDAHPVGATVVV 90 Query: 108 MDDLYGGTFRLFERVRRRTAGLDFSFVDLTDPAAF-KAAIRADTKMVWIETPTNPMLKLV 166 D Y GT F + T + V+ TD A + +AA AD ++W+E+PTNP L +V Sbjct: 91 PRDSYAGTRSYFGH-EQETGRVKVVSVEPTDTARWIEAAAEAD--LLWLESPTNPSLHVV 147 Query: 167 DIAAIAVIARKHG--LLTVVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAV 224 DIAAIA ARK TVVDNTFA+P+ Q+PLSLGAD+VVHSATK++ GHSD++ G AV Sbjct: 148 DIAAIAEAARKTPGRPTTVVDNTFATPLGQQPLSLGADIVVHSATKFIGGHSDLLLGAAV 207 Query: 225 VGDNAELAEQMAFLQNSIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPA 284 D A + + + IG G ++FLALRGL+TLP+R A LA+ L H A Sbjct: 208 ATDPAHV-RALRDARTRIGATPGALEAFLALRGLRTLPVRFAEASRTAAMLAERLGAHAA 266 Query: 285 IEKVIYPGLASHPQHVLAKRQMSGFGGIVSIVLKGGFDAAKRFCEKTELFTLAESLGGVE 344 + +V YPG G + D A CE L A SLGGVE Sbjct: 267 VTRVRYPG-----------------SGAMLAFEVADADRADAVCEALRLVRHATSLGGVE 309 Query: 345 SLVNHPAVMTHASIPVARREQLGISDALVRLSVGIEDLGDLRGDLERALVNQN 397 S V A AR ++ L+RLS+G+ED DL DL RAL + N Sbjct: 310 STVERRA---------ARSGDAHVASGLLRLSIGLEDPEDLWADLNRALCSVN 353 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 22 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 353 Length adjustment: 30 Effective length of query: 367 Effective length of database: 323 Effective search space: 118541 Effective search space used: 118541 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory