Align Intracellular chorismate mutase; CM; EC 5.4.99.5 (characterized)
to candidate WP_005453415.1 SACCYDRAFT_RS02885 chorismate mutase
Query= SwissProt::A0R3N5 (104 letters) >NCBI__GCF_000244975.1:WP_005453415.1 Length = 98 Score = 101 bits (251), Expect = 3e-27 Identities = 54/93 (58%), Positives = 66/93 (70%), Gaps = 1/93 (1%) Query: 11 HDEEPHMPETIDAVPEIDDLRREIDELDATIIAAIQRRTEVSKTIGKARMASGGTRLVHS 70 HD + EID LR+EID LDA I+ ++RR EVSKTIG ARMA+GG R+V++ Sbjct: 6 HDTDEAGRSGATTAEEIDQLRKEIDWLDAEILRLVKRRAEVSKTIGAARMAAGGPRIVYN 65 Query: 71 REMKVIERYIDALGPEGKDLAMLLLRLGRGRLG 103 REM V+ RY + LGPEG+ LAM LL LGRGRLG Sbjct: 66 REMDVLARYRE-LGPEGRQLAMALLNLGRGRLG 97 Lambda K H 0.319 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 51 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 104 Length of database: 98 Length adjustment: 11 Effective length of query: 93 Effective length of database: 87 Effective search space: 8091 Effective search space used: 8091 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.8 bits) S2: 39 (19.6 bits)
Align candidate WP_005453415.1 SACCYDRAFT_RS02885 (chorismate mutase)
to HMM TIGR01808 (chorismate mutase (EC 5.4.99.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01808.hmm # target sequence database: /tmp/gapView.19624.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01808 [M=74] Accession: TIGR01808 Description: CM_M_hiGC-arch: chorismate mutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-35 105.2 0.3 9.1e-35 104.9 0.3 1.1 1 lcl|NCBI__GCF_000244975.1:WP_005453415.1 SACCYDRAFT_RS02885 chorismate mu Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000244975.1:WP_005453415.1 SACCYDRAFT_RS02885 chorismate mutase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 104.9 0.3 9.1e-35 9.1e-35 1 74 [] 21 94 .. 21 94 .. 0.99 Alignments for each domain: == domain 1 score: 104.9 bits; conditional E-value: 9.1e-35 TIGR01808 1 eikklReEidrlDaeilslvKrRleisqaiGKirkesggtrlvrkREvevierfaelGeegkelaellLrl 71 ei++lR+Eid lDaeil lvKrR+e+s++iG +r++ gg+r v +RE++v+ r+ elG+eg++la lL+l lcl|NCBI__GCF_000244975.1:WP_005453415.1 21 EIDQLRKEIDWLDAEILRLVKRRAEVSKTIGAARMAAGGPRIVYNREMDVLARYRELGPEGRQLAMALLNL 91 79********************************************************************* PP TIGR01808 72 grg 74 grg lcl|NCBI__GCF_000244975.1:WP_005453415.1 92 GRG 94 *97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (74 nodes) Target sequences: 1 (98 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 2.62 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory