Align anthranilate phosphoribosyltransferase (EC 2.4.2.18) (characterized)
to candidate WP_005454544.1 SACCYDRAFT_RS06095 anthranilate phosphoribosyltransferase
Query= BRENDA::A5U4M0 (370 letters) >NCBI__GCF_000244975.1:WP_005454544.1 Length = 341 Score = 364 bits (935), Expect = e-105 Identities = 192/342 (56%), Positives = 233/342 (68%), Gaps = 5/342 (1%) Query: 26 SWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGV 85 +WP +L +L + DL+ AWAMDQ+M+G A PAQIA FAVA+ K T E+ +A Sbjct: 5 TWPAVLNQLIERVDLSEDATAWAMDQVMSGEATPAQIAGFAVALRAKGETPAEISGMAKA 64 Query: 86 MLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLS 145 ML+H+ + T VD+VGTGGD +VN+STM ++VVAAAG PVVKHGNRAASS S Sbjct: 65 MLAHSKRIDLGT---RTVDIVGTGGDRKGSVNISTMTSLVVAAAGTPVVKHGNRAASSKS 121 Query: 146 GGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLL 205 G AD LEALGV I+ PD V R + E+GIGFCFAP FHP+YRH RRE+GV T FNLL Sbjct: 122 GAADVLEALGVTIESEPDDVRRCVEELGIGFCFAPVFHPAYRHTGPPRRELGVSTAFNLL 181 Query: 206 GPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVA 265 GPLTNPA+P +GLIGCA+ D A V+A V+A R SVL+V GDDG DE+TTTTTST W V+ Sbjct: 182 GPLTNPAQPSSGLIGCAYLDKAPVLAEVYARRGHSVLLVRGDDGFDEITTTTTSTAWVVS 241 Query: 266 AGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIV 325 G V T DP G + D L GGDA ANA V+ ++GG GPVRDAV+LNAAGA+ Sbjct: 242 NGQVRTTTIDPETLGIPLSTPDALRGGDAAANAEVVKELVGGKTGPVRDAVLLNAAGALA 301 Query: 326 AHAGLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFG 367 A AG S + GL A+ AID+GAA LL RW+ G Sbjct: 302 AFAGFSD--DLTADLRAGLELATRAIDSGAAADLLTRWINRG 341 Lambda K H 0.318 0.132 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 341 Length adjustment: 29 Effective length of query: 341 Effective length of database: 312 Effective search space: 106392 Effective search space used: 106392 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_005454544.1 SACCYDRAFT_RS06095 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.8955.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-116 373.6 0.0 5.2e-116 373.5 0.0 1.0 1 lcl|NCBI__GCF_000244975.1:WP_005454544.1 SACCYDRAFT_RS06095 anthranilate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000244975.1:WP_005454544.1 SACCYDRAFT_RS06095 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 373.5 0.0 5.2e-116 5.2e-116 1 329 [. 10 339 .. 10 340 .. 0.97 Alignments for each domain: == domain 1 score: 373.5 bits; conditional E-value: 5.2e-116 TIGR01245 1 leklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeese 69 l++l+++ dLse+ +++m+++msgea++aqia + valr+kget+ ei+g+aka+++++k+++ + lcl|NCBI__GCF_000244975.1:WP_005454544.1 10 LNQLIERVDLSEDATAWAMDQVMSGEATPAQIAGFAVALRAKGETPAEISGMAKAMLAHSKRIDLG--T 76 5799***********************************************************985..9 PP TIGR01245 70 elvDivGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsl 138 + vDivGTGGD ++NiST+++lv+aaaG++v+KhGnr++ssksG+aDvLealgv++e +p+ v+r++ lcl|NCBI__GCF_000244975.1:WP_005454544.1 77 RTVDIVGTGGDRKGSVNISTMTSLVVAAAGTPVVKHGNRAASSKSGAADVLEALGVTIESEPDDVRRCV 145 ********************************************************************* PP TIGR01245 139 eevgigFlfAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlg 207 ee+gigF+fAP +hpa+++ p R+eLgv t fNlLGPL+nPa+++ ++G++ d + vlaev + g lcl|NCBI__GCF_000244975.1:WP_005454544.1 146 EELGIGFCFAPVFHPAYRHTGPPRRELGVSTAFNLLGPLTNPAQPSSGLIGCAYLDKAPVLAEVYARRG 214 ********************************************************************* PP TIGR01245 208 vkralvvhgedglDEisltgetkvaelkdgeieeytlspedfglkraeleelkggsaeenaellkevle 276 + +l+v+g+dg DEi++t++++ + +++g+++++t++pe++g++ + ++l+gg+a++nae++ke++ lcl|NCBI__GCF_000244975.1:WP_005454544.1 215 HS-VLLVRGDDGFDEITTTTTSTAWVVSNGQVRTTTIDPETLGIPLSTPDALRGGDAAANAEVVKELVG 282 99.**************************************************************9888 PP TIGR01245 277 gkekkakrdivvlNaaaalyvagka.....kdlkegvelakeaiksgkalekleelva 329 gk ++ rd+v+lNaa al + + +dl++g+ela +ai+sg+a+++l+++++ lcl|NCBI__GCF_000244975.1:WP_005454544.1 283 GKT-GPVRDAVLLNAAGALAAFAGFsddltADLRAGLELATRAIDSGAAADLLTRWIN 339 777.9**************9876655666699**********************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (341 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.90 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory