Align 3-isopropylmalate dehydrogenase; 3-IPM-DH; IMDH; EC 1.1.1.85; Beta-IPM dehydrogenase (uncharacterized)
to candidate WP_005456797.1 SACCYDRAFT_RS13140 isocitrate dehydrogenase
Query= curated2:O29627 (326 letters) >NCBI__GCF_000244975.1:WP_005456797.1 Length = 481 Score = 214 bits (545), Expect = 3e-60 Identities = 126/312 (40%), Positives = 178/312 (57%), Gaps = 7/312 (2%) Query: 4 IVVIPGDGIGKEVMEAAMLILEKLDLPFEYSYYDAGDEALEKYGKA-LPDETLEACRKSD 62 I V GDGIG E+MEA + +L + G+ + A + E LE+ R++ Sbjct: 10 ITVAHGDGIGPEIMEATLSVLNAAGAALDIDTITIGESVYQAGNPAGVTPEALESIRRTG 69 Query: 63 AVLFGAA----GETAADVIVRLRRELGTFANVRPAKAIEG-IECLYPGLDIVVVRENTEC 117 L G + V +R+ G +ANVRP A + +PG+D+V+VREN E Sbjct: 70 VFLKAPITTPQGGGFKSLNVTVRKTFGLYANVRPCVAYAPFVATKHPGMDVVIVRENEED 129 Query: 118 LYMGFEFGFGD-VTEAIRVITREASERIARYAFELAKREGRKKVTALHKANVMKKTCGLF 176 LY G E D V + +++I+R+ ER+ RYAFE A R KVTA K N+MK T GLF Sbjct: 130 LYAGIEHRQTDEVVQCLKLISRQGCERVIRYAFEYATAYRRTKVTAFTKDNIMKMTDGLF 189 Query: 177 RDVCREVAKDYPEIQYNDYYIDAACMYLVMDPFRFDVIVTTNMFGDIVSDLAAGLVGGLG 236 V EVA DYP+IQ + +D L P FDV+V N++GDI+SD+AA + G +G Sbjct: 190 HRVFDEVAADYPDIQAEHWIVDIGAAKLADTPEAFDVVVLPNLYGDILSDVAAQIAGSVG 249 Query: 237 LAPSANVGERTAIFEPVHGAAFDIAGKGIANPTAMILTACMMLRHFGYVEEAKKVEEAVE 296 LA SAN+GER A+FE +HG+A AG+ +ANP+ ++L A ML H G + A +V A Sbjct: 250 LAGSANIGERVAMFEAIHGSAPRRAGQDVANPSGLLLAAVQMLVHIGQADVASRVHNAWL 309 Query: 297 KTIKEGKKTPDL 308 +TI++G T D+ Sbjct: 310 RTIEDGIHTYDI 321 Lambda K H 0.321 0.139 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 481 Length adjustment: 31 Effective length of query: 295 Effective length of database: 450 Effective search space: 132750 Effective search space used: 132750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory