Align ornithine carbamoyltransferase (EC 2.1.3.3) (characterized)
to candidate WP_005457884.1 SACCYDRAFT_RS16635 ornithine carbamoyltransferase
Query= BRENDA::P0A5M9 (307 letters) >NCBI__GCF_000244975.1:WP_005457884.1 Length = 308 Score = 439 bits (1128), Expect = e-128 Identities = 221/306 (72%), Positives = 250/306 (81%), Gaps = 1/306 (0%) Query: 1 MIRHFLRDDDLSPAEQAEVLELAAELKKDPVSRRPLQGPRGVAVIFDKNSTRTRFSFELG 60 M RHFLRDDDL+P+EQAEVL+LAA+LK+ P L GP+ VAVIF+KNSTRTRFSFE G Sbjct: 1 MPRHFLRDDDLTPSEQAEVLDLAAKLKQQPYGDA-LAGPKTVAVIFEKNSTRTRFSFEAG 59 Query: 61 IAQLGGHAVVVDSGSTQLGRDETLQDTAKVLSRYVDAIVWRTFGQERLDAMASVATVPVI 120 I+QLGGHAVVVD S QLGR+ET+ DTA+VLSRY D +VWRTFGQER+D A+ ATVPV+ Sbjct: 60 ISQLGGHAVVVDGHSMQLGREETIGDTARVLSRYTDLVVWRTFGQERIDEFAAAATVPVV 119 Query: 121 NALSDEFHPCQVLADLQTIAERKGALRGLRLSYFGDGANNMAHSLLLGGVTAGIHVTVAA 180 NAL+DEFHPCQ+LADL T+ ERKGAL GL L+Y GDGANNMAHSLLLGGVTAG+HV VAA Sbjct: 120 NALTDEFHPCQILADLFTVRERKGALAGLTLTYLGDGANNMAHSLLLGGVTAGMHVRVAA 179 Query: 181 PEGFLPDPSVRAAAERRAQDTGASVTVTADAHAAAAGADVLVTDTWTSMGQENDGLDRVK 240 PEGF P P V A +RA++TG S V D HAA GADV+ TD WTSMGQE DG DRV Sbjct: 180 PEGFHPLPWVLDAVAKRAEETGGSAAVFTDPHAAVDGADVVTTDAWTSMGQEGDGKDRVT 239 Query: 241 PFRPFQLNSRLLALADSDAIVLHCLPAHRGDEITDAVMDGPASAVWDEAENRLHAQKALL 300 PF P+Q+N+ LLA D IVLH LPAHRG EITD V+DGPASAVWDEAENRLHAQKALL Sbjct: 240 PFLPYQVNTDLLARTGKDTIVLHDLPAHRGMEITDEVIDGPASAVWDEAENRLHAQKALL 299 Query: 301 VWLLER 306 VWLL + Sbjct: 300 VWLLRQ 305 Lambda K H 0.319 0.133 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 308 Length adjustment: 27 Effective length of query: 280 Effective length of database: 281 Effective search space: 78680 Effective search space used: 78680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_005457884.1 SACCYDRAFT_RS16635 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00658.hmm # target sequence database: /tmp/gapView.31947.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-115 370.2 0.0 4.3e-115 370.0 0.0 1.0 1 lcl|NCBI__GCF_000244975.1:WP_005457884.1 SACCYDRAFT_RS16635 ornithine car Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000244975.1:WP_005457884.1 SACCYDRAFT_RS16635 ornithine carbamoyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 370.0 0.0 4.3e-115 4.3e-115 1 303 [. 3 303 .. 3 304 .. 0.98 Alignments for each domain: == domain 1 score: 370.0 bits; conditional E-value: 4.3e-115 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGaqvl 69 rh+l dl+++e e+l+la+klk++ + + + kt+a+iFek+stRtR sfe+++ +lG++++ lcl|NCBI__GCF_000244975.1:WP_005457884.1 3 RHFLRDDDLTPSEQAEVLDLAAKLKQQPYGD---ALAGPKTVAVIFEKNSTRTRFSFEAGISQLGGHAV 68 799999********************99983...44456****************************** PP TIGR00658 70 ylnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDllt 138 +++ +++qlgr+e+i Dtarvlsry d +v R++ +e + e+a a+vPv+n+Ltd++hPcqilaDl+t lcl|NCBI__GCF_000244975.1:WP_005457884.1 69 VVDGHSMQLGREETIGDTARVLSRYTDLVVWRTFGQERIDEFAAAATVPVVNALTDEFHPCQILADLFT 137 ********************************************************************* PP TIGR00658 139 ikeklgklkevklvyvGDa.nnvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggklel 206 ++e++g+l +++l+y+GD+ nn+a+slll++++ G++v+va+Peg++p + +++ k a+e+gg+ + lcl|NCBI__GCF_000244975.1:WP_005457884.1 138 VRERKGALAGLTLTYLGDGaNNMAHSLLLGGVTAGMHVRVAAPEGFHPLPWVLDAVAKRAEETGGSAAV 206 *******************9************************************************* PP TIGR00658 207 tedpkkavkdadviytDvwvsmGeeekkeerlkllkpyqvneellelakpevkflhCLPavrGeevtde 275 dp+ av +adv+ tD w+smG+e + ++r+ + pyqvn++ll+ + +++++lh LPa+rG+e+tde lcl|NCBI__GCF_000244975.1:WP_005457884.1 207 FTDPHAAVDGADVVTTDAWTSMGQEGDGKDRVTPFLPYQVNTDLLARTGKDTIVLHDLPAHRGMEITDE 275 ********************************************************************* PP TIGR00658 276 vlegeasivfdeaenRlhaqkavlkall 303 v++g+as v+deaenRlhaqka+l++ll lcl|NCBI__GCF_000244975.1:WP_005457884.1 276 VIDGPASAVWDEAENRLHAQKALLVWLL 303 *************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (308 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.32 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory