Align [amino group carrier protein]-gamma-(L-lysyl)-L-glutamate aminotransferase (EC 2.6.1.118) (characterized)
to candidate WP_005457886.1 SACCYDRAFT_RS16640 acetylornithine transaminase
Query= BRENDA::Q93R93 (395 letters) >NCBI__GCF_000244975.1:WP_005457886.1 Length = 395 Score = 284 bits (727), Expect = 3e-81 Identities = 159/362 (43%), Positives = 210/362 (58%), Gaps = 1/362 (0%) Query: 31 IVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQTLPTPMRG 90 +VRG+GA VWDA+G Y+D V G V LGH +P VV AV RQ T+ Sbjct: 25 LVRGEGAVVWDADGRRYLDFVTGIAVNALGHAHPAVVSAVTRQIATIGHTSNLYLNEPAL 84 Query: 91 EFYRTLTAILPPELNRVFPVNSGTEANEAALKFARAHTGRKKFVAAMRGFSGRTMGSLSV 150 L + +V NSG EA EAA K AR TGR VA GF GRTMG+L++ Sbjct: 85 TLAERLLELSGAGDGKVLFCNSGAEAVEAAFKLAR-RTGRSTVVATEGGFHGRTMGALAL 143 Query: 151 TWEPKYREPFLPLVEPVEFIPYNDVEALKRAVDEETAAVILEPVQGEGGVRPATPEFLRA 210 T +P R PF PLV V +P+ DV AL+RA+D +TAA ++EPVQGE GV ++LRA Sbjct: 144 TGQPAKRAPFEPLVPGVRHVPFGDVPALERAIDSDTAAFVVEPVQGENGVVVPGDDYLRA 203 Query: 211 AREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGGVPLGVAVMREE 270 AREIT+ G LL++DE+QTG+GR G FA++ GI PD++TLAK LGGG+PLG + E Sbjct: 204 AREITRRHGVLLVVDEVQTGVGRLGSWFAYQQTGIQPDVVTLAKGLGGGLPLGACLAFGE 263 Query: 271 VARSMPKGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRAIPSPKIR 330 A G HGTTFGGNP+ AAG+A + + L E A LG L + P +R Sbjct: 264 AATLFEPGQHGTTFGGNPVCCAAGLAVLDTIAANGLLEHTAALGKEISAGLERLDHPLVR 323 Query: 331 EVRGMGLMVGLELKEKAAPYIARLEKEHRVLALQAGPTVIRFLPPLVIEKEDLERVVEAV 390 VRG GL++G+ L + +A + L P V+R PPLV+ +E + ++ A+ Sbjct: 324 TVRGAGLLLGVVLNSAVSAGVAAAAQRAGFLVNPVQPDVVRLAPPLVVSQEQADALLAAL 383 Query: 391 RA 392 A Sbjct: 384 PA 385 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 410 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 395 Length adjustment: 31 Effective length of query: 364 Effective length of database: 364 Effective search space: 132496 Effective search space used: 132496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory