Align acetylglutamate kinase (EC 2.7.2.8) (characterized)
to candidate WP_005457887.1 SACCYDRAFT_RS16645 acetylglutamate kinase
Query= BRENDA::Q6R6P5 (317 letters) >NCBI__GCF_000244975.1:WP_005457887.1 Length = 309 Score = 407 bits (1046), Expect = e-118 Identities = 194/282 (68%), Positives = 239/282 (84%) Query: 13 RANVLAEALPWLQHFRDKIVVVKYGGNAMVDDDLKAAFAADMVFLRTVGAKPVVVHGGGP 72 +A+VL EALPWLQ F VVVKYGGNAMVDD+LK AFA DMVFLR G +PVVVHGGGP Sbjct: 20 KASVLIEALPWLQRFHGATVVVKYGGNAMVDDELKRAFAQDMVFLRIAGLRPVVVHGGGP 79 Query: 73 QISEMLNRVGLQGEFKGGFRVTTPEVMDIVRMVLFGQVGRDLVGLINSHGPYAVGTSGED 132 QI+ ML+R+G++GEFKGG RVTTPE MD+VRMVL GQV R+LVGLIN+HGPYAVG SGED Sbjct: 80 QITAMLDRLGIKGEFKGGLRVTTPETMDVVRMVLVGQVSRELVGLINAHGPYAVGISGED 139 Query: 133 AGLFTAQKRMVNIDGVPTDIGLVGDIINVDASSLMDIIEAGRIPVVSTIAPGEDGQIYNI 192 A LFTA+++ +DG P D+GLVG++++V+ +++DI+ AGRIPVVST+AP DG ++N+ Sbjct: 140 ARLFTAERKQATVDGEPVDVGLVGEVVDVNPDAVLDIVNAGRIPVVSTVAPDTDGVVHNV 199 Query: 193 NADTAAGALAAAIGAERLLVLTNVEGLYTDWPDKSSLVSKIKATELEAILPGLDSGMIPK 252 NADTAAGALA+A+ AE+L+VLT+VEGLY +WPD+SSLV +I A ELE +LP L SGMIPK Sbjct: 200 NADTAAGALASALRAEKLVVLTDVEGLYANWPDRSSLVDRIDADELENLLPSLASGMIPK 259 Query: 253 MESCLNAVRGGVSAAHVIDGRIAHSVLLELLTMGGIGTMVLP 294 ME+CL A+RGGV AHVIDGR+AHSVLLE+ T G+GTMV+P Sbjct: 260 MEACLRAIRGGVRRAHVIDGRLAHSVLLEVFTSRGVGTMVVP 301 Lambda K H 0.319 0.139 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 364 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 309 Length adjustment: 27 Effective length of query: 290 Effective length of database: 282 Effective search space: 81780 Effective search space used: 81780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_005457887.1 SACCYDRAFT_RS16645 (acetylglutamate kinase)
to HMM TIGR00761 (argB: acetylglutamate kinase (EC 2.7.2.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00761.hmm # target sequence database: /tmp/gapView.15360.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00761 [M=231] Accession: TIGR00761 Description: argB: acetylglutamate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-84 268.3 0.3 3.2e-84 268.1 0.3 1.1 1 lcl|NCBI__GCF_000244975.1:WP_005457887.1 SACCYDRAFT_RS16645 acetylglutama Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000244975.1:WP_005457887.1 SACCYDRAFT_RS16645 acetylglutamate kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 268.1 0.3 3.2e-84 3.2e-84 1 231 [] 38 276 .. 38 276 .. 0.97 Alignments for each domain: == domain 1 score: 268.1 bits; conditional E-value: 3.2e-84 TIGR00761 1 tiViKiGGaais..elleelakdiaklrkegiklvivHGGgpeinelleklgievefvnglRvTdketl 67 t+V+K+GG+a+ el++++a+d+++lr g+++v+vHGGgp+i+++l++lgi+ ef++glRvT+ et+ lcl|NCBI__GCF_000244975.1:WP_005457887.1 38 TVVVKYGGNAMVddELKRAFAQDMVFLRIAGLRPVVVHGGGPQITAMLDRLGIKGEFKGGLRVTTPETM 106 69*********9999****************************************************** PP TIGR00761 68 evvemvligkvnkelvallekhgikavGltgkDgqlltaekldke......dlgyvGeikkvnkellea 130 +vv+mvl+g+v +elv l++ hg +avG++g+D++l+tae+ + d+g+vGe+ vn++++ + lcl|NCBI__GCF_000244975.1:WP_005457887.1 107 DVVRMVLVGQVSRELVGLINAHGPYAVGISGEDARLFTAERKQATvdgepvDVGLVGEVVDVNPDAVLD 175 ****************************************555555588******************** PP TIGR00761 131 llkagiipviaslaldeegqllNvnaDtaAaelAaaleAekLvlLtdvaGileg..dkksliselelee 197 +++ag ipv++++a d +g ++NvnaDtaA++lA+al AekLv+Ltdv+G++++ d++sl+++++++e lcl|NCBI__GCF_000244975.1:WP_005457887.1 176 IVNAGRIPVVSTVAPDTDGVVHNVNADTAAGALASALRAEKLVVLTDVEGLYANwpDRSSLVDRIDADE 244 ********************************************************************* PP TIGR00761 198 ieqlikqavikgGmipKveaalealesgvkkvvi 231 +e+l+ + +++GmipK+ea+l+a+++gv+++++ lcl|NCBI__GCF_000244975.1:WP_005457887.1 245 LENLLPS--LASGMIPKMEACLRAIRGGVRRAHV 276 ******9..7*********************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (231 nodes) Target sequences: 1 (309 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.93 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory