Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_005813040.1 DHAF_RS15220 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_000021925.1:WP_005813040.1 Length = 286 Score = 148 bits (373), Expect = 2e-40 Identities = 95/282 (33%), Positives = 152/282 (53%), Gaps = 12/282 (4%) Query: 95 LRVAYLGPEGTFSQAAALKHF---GHSVISKPMAAID-EVFREVVAGAVNFGV----VPV 146 + + YLGP+G+FS+ A L+ F ++ P+ I +++ N + VP+ Sbjct: 2 MNIGYLGPKGSFSEEA-LQLFLTTQSDLLEPPLNLIPFTTIPKLLIACQNLEIEGAFVPL 60 Query: 147 ENSTEGAVNHTLDSFLEHD-IVICGEVELRIHHHLLVGETTKTDRITRIYSHAQSLAQCR 205 ENSTEG V T+D + + + I E + L+ + +I ++YSH Q+L QCR Sbjct: 61 ENSTEGQVGVTMDMLGQTESLYIMREFIFPVDQCLITAQPLHLAQIKQVYSHEQALGQCR 120 Query: 206 KWLDAHYPNVERVAVSSNADAAKRVKSEWNS--AAIAGDMAAQLYGLSKLAEKIEDRPVN 263 +L+ H E+ + S A+A ++ + AAI AA++Y L +EKI+D +N Sbjct: 121 DFLETHLAQAEQHSSPSTAEAVTKIAQNPDQPWAAIGPRRAAEIYNLHCKSEKIQDSMLN 180 Query: 264 STRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELLMPFHSNGIDLTRIETRPSRSGKW 323 +TRF+ +G +DKTS+++ + PGAL L F I+L+RIE+RPS+ Sbjct: 181 ATRFIFVGHHLAEMNEEDKTSLLIITGDTPGALAHALQEFALRNINLSRIESRPSKKKLG 240 Query: 324 TYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYPKAVL 365 YVFF+D G+ P I+ L + + V+ K+LGSYPKA L Sbjct: 241 EYVFFVDIDGYVFSPSIQEALWALKDKGVSTKLLGSYPKAKL 282 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 286 Length adjustment: 28 Effective length of query: 337 Effective length of database: 258 Effective search space: 86946 Effective search space used: 86946 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory