Align 3-isopropylmalate dehydrogenase; 3-IPM-DH; Beta-IPM dehydrogenase; IMDH; EC 1.1.1.85 (characterized)
to candidate WP_005816724.1 DHAF_RS12335 3-isopropylmalate dehydrogenase
Query= SwissProt::P12010 (366 letters) >NCBI__GCF_000021925.1:WP_005816724.1 Length = 352 Score = 398 bits (1022), Expect = e-115 Identities = 210/353 (59%), Positives = 258/353 (73%), Gaps = 4/353 (1%) Query: 4 KLAVLPGDGIGPEVMDAAIRVLKTVLDNDGHEAVFENALIGGAAIDEAGTPLPEETLDIC 63 K+AVLPGDGIG E++ A+RVLK VL E F++ IGGAAI+ G LP+ETL C Sbjct: 3 KIAVLPGDGIGQEIIPQAVRVLKAVLAETDAEFEFQDYPIGGAAIELVGKALPDETLQGC 62 Query: 64 RRSDAILLGAVGGPKWDHNPASLRPEKG-LLGLRKEMGLFANLRPVKAYATLLNASPLKR 122 R +DA+LLGAVGG +WDH PAS RPE LLGLRK + +AN+RPV+ +LL S LK Sbjct: 63 READAVLLGAVGGHQWDHLPASERPETAALLGLRKGLNFYANIRPVRMIPSLLATSTLKE 122 Query: 123 ERVENVDLVIVRELTGGLYFGRPSERRGPGENEVVDTLAYTREEIERIIEKAFQLAQIRR 182 ++ VD+V++RELTGG+YFG P D + Y+ EEI RI+ + F+ A +R Sbjct: 123 NVLDGVDMVVIRELTGGVYFGEKGRSDNP--RSAYDKMTYSEEEIRRILIQGFETAMLRS 180 Query: 183 KKLASVDKANVLESSRMWREIAEETAKKYPDVELSHMLVDSTSMQLIANPGQFDVIVTEN 242 KKL SVDKANVLE+SR+WREIA E AK+YP+VEL+HM VD+ +MQL+ NP QFDVIVTEN Sbjct: 181 KKLCSVDKANVLETSRLWREIANELAKEYPEVELTHMYVDNAAMQLVRNPKQFDVIVTEN 240 Query: 243 MFGDILSDEASVITGSLGMLPSASLRSDRFGMYEPVHGSAPDIAGQGKANPLGTVLSAAL 302 MFGDIL+D AS++ GS+GML SASL S GMYEP HGSAPDIAG+ ANPL T+LSAAL Sbjct: 241 MFGDILTDLASMLGGSIGMLSSASL-SGTQGMYEPAHGSAPDIAGKNLANPLATILSAAL 299 Query: 303 MLRYSFGLEKEAAAIEKAVDDVLQDGYCTGDLQVANGKVVSTIELTDRLIEKL 355 MLRYSFG+E EA IE AV+ VL+ GY TGDL A KVV TIE+ D ++ L Sbjct: 300 MLRYSFGMEAEALRIESAVEKVLEQGYRTGDLAQAGDKVVGTIEMGDAVLAAL 352 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 417 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 366 Length of database: 352 Length adjustment: 29 Effective length of query: 337 Effective length of database: 323 Effective search space: 108851 Effective search space used: 108851 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_005816724.1 DHAF_RS12335 (3-isopropylmalate dehydrogenase)
to HMM TIGR00169 (leuB: 3-isopropylmalate dehydrogenase (EC 1.1.1.85))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00169.hmm # target sequence database: /tmp/gapView.26000.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00169 [M=349] Accession: TIGR00169 Description: leuB: 3-isopropylmalate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-152 492.0 0.0 5.4e-152 491.8 0.0 1.0 1 lcl|NCBI__GCF_000021925.1:WP_005816724.1 DHAF_RS12335 3-isopropylmalate d Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000021925.1:WP_005816724.1 DHAF_RS12335 3-isopropylmalate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 491.8 0.0 5.4e-152 5.4e-152 1 348 [. 3 347 .. 3 348 .. 0.98 Alignments for each domain: == domain 1 score: 491.8 bits; conditional E-value: 5.4e-152 TIGR00169 1 kiavLpGDgiGpevvaealkvLkaveerfelklefeealiGGaaidatgePlpeetlkackeadavLlg 69 kiavLpGDgiG+e++ +a++vLkav +++ ++ef+++ iGGaai+ +g+ lp+etl++c+eadavLlg lcl|NCBI__GCF_000021925.1:WP_005816724.1 3 KIAVLPGDGIGQEIIPQAVRVLKAVLAETDAEFEFQDYPIGGAAIELVGKALPDETLQGCREADAVLLG 71 79******************************************************************* PP TIGR00169 70 avGGpkWdnlprdvrPek.gLLklrkeldlfanLrPaklfksLeklsplkeeivkgvDlvvvreLtgGi 137 avGG +Wd+lp++ rPe+ +LL lrk l+++an+rP+++++sL+++s+lke++ +gvD+vv+reLtgG+ lcl|NCBI__GCF_000021925.1:WP_005816724.1 72 AVGGHQWDHLPASERPETaALLGLRKGLNFYANIRPVRMIPSLLATSTLKENVLDGVDMVVIRELTGGV 140 *****************989************************************************* PP TIGR00169 138 YfGepkereeaeeekkaldtekYtkeeieriarvafelarkrrkkvtsvDkanvLessrlWrktveeia 206 YfGe+ +++ ++a+d ++Y++eei+ri ++fe+a+ r kk++svDkanvLe+srlWr++++e+a lcl|NCBI__GCF_000021925.1:WP_005816724.1 141 YFGEKGRSDN---PRSAYDKMTYSEEEIRRILIQGFETAMLRSKKLCSVDKANVLETSRLWREIANELA 206 ***9766655...89****************************************************** PP TIGR00169 207 keyPdvelehlyiDnaamqLvksPeqldvvvtsnlfGDilsDeasvitGslGlLPsaslsskglalfep 275 keyP+vel h+y+DnaamqLv++P+q+dv+vt+n+fGDil D as++ Gs+G+L sasls +++++ep lcl|NCBI__GCF_000021925.1:WP_005816724.1 207 KEYPEVELTHMYVDNAAMQLVRNPKQFDVIVTENMFGDILTDLASMLGGSIGMLSSASLS-GTQGMYEP 274 ************************************************************.78899*** PP TIGR00169 276 vhgsapdiagkgianpiaailsaalllryslnleeaaeaieaavkkvleegkrtedlaseattavstke 344 +hgsapdiagk++anp+a+ilsaal+lrys+++e +a +ie+av+kvle+g+rt dla+ + + v+t e lcl|NCBI__GCF_000021925.1:WP_005816724.1 275 AHGSAPDIAGKNLANPLATILSAALMLRYSFGMEAEALRIESAVEKVLEQGYRTGDLAQAGDKVVGTIE 343 *************************************************************99999999 PP TIGR00169 345 veee 348 +++ lcl|NCBI__GCF_000021925.1:WP_005816724.1 344 MGDA 347 9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (352 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.21 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory