Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate WP_006746632.1 THITH_RS16785 2-hydroxyacid dehydrogenase
Query= BRENDA::P9WNX3 (528 letters) >NCBI__GCF_000227685.2:WP_006746632.1 Length = 335 Score = 153 bits (386), Expect = 1e-41 Identities = 95/300 (31%), Positives = 154/300 (51%), Gaps = 17/300 (5%) Query: 16 TVAALGDQVEVRWVDGPDRDKLLAAVPEADALLVRSATTVDAEVLAAAPK--LKIVARAG 73 T AA V+ +++ + A+A+ +D EVL A + +VA Sbjct: 23 TQAATDSNVQFHFLEPRLEPDTVVLAQGANAICAFVNDRLDREVLTALKDAGIDLVALRC 82 Query: 74 VGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIPAADASLREHTWKRSS 133 G +NVD+ AA GV V P + ++ AEHA AL++ +R+ A +RE + Sbjct: 83 AGFNNVDLKAAEEIGVRVARVPAYSPNAVAEHAAALIMTLNRKTHRAFNRVREGNFLLDG 142 Query: 134 FSGTEIFGKTVGVVGLGRIGQLVAQRIAAFGAYVVAYDPYVSPARAAQLGIELLSLDDLL 193 G ++ G TVG+VG GRIG+ A+ + FG +VA+DPY P ++GIE L + L Sbjct: 143 LMGFDVNGCTVGIVGTGRIGRSFARIMQGFGCEIVAFDPYPDP-EVEEMGIEYLPWEGFL 201 Query: 194 ARADFISVHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAA 253 R+D IS+H P TPET ++D++A++ KPGV+++N +RG +VD A+ D + G + + Sbjct: 202 NRSDIISLHCPLTPETHAMVDEKAISLMKPGVMLINTSRGAIVDTHAVIDGLKSGRIGSL 261 Query: 254 GLDVF----------ATEPCTDSPLFE----LAQVVVTPHLGASTAEAQDRAGTDVAESV 299 GLDV+ +E +F+ V++T H G T +A + E++ Sbjct: 262 GLDVYEQEENLFFKDLSEEVIQDDVFQRLLTFPNVLITGHQGFLTRQAMEEIARTTVENL 321 Lambda K H 0.317 0.133 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 330 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 528 Length of database: 335 Length adjustment: 32 Effective length of query: 496 Effective length of database: 303 Effective search space: 150288 Effective search space used: 150288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory