Align amino-acid N-acetyltransferase (EC 2.3.1.1) (characterized)
to candidate WP_006747000.1 THITH_RS14955 amino-acid N-acetyltransferase
Query= BRENDA::P22567 (432 letters) >NCBI__GCF_000227685.2:WP_006747000.1 Length = 440 Score = 414 bits (1064), Expect = e-120 Identities = 224/442 (50%), Positives = 293/442 (66%), Gaps = 26/442 (5%) Query: 5 VNWLRHASPYINSHRDRTFVVMLPGEGVEHPNFGNIVHDLVLLHSLGARLVLVHGSRPQI 64 ++W R A PYI +HRDRT V+ + GE + F ++ D+ L +LG R+VLVHG+RPQI Sbjct: 10 LDWFRAAVPYIVAHRDRTMVIAIAGEAAQALEFPTLLRDIAQLQALGTRVVLVHGARPQI 69 Query: 65 EARLAARGLAPRYHRDLRVTDAPTLECVIDAVGSLRIAIEARLSMDMAASPMQGARLRVA 124 EARL RGL PRY LRVTDA LE V DAVG LR+ IE LS ++ + GARLRVA Sbjct: 70 EARLRERGLTPRYAAGLRVTDAAALEAVCDAVGRLRLHIEGLLSRNLGNPGIAGARLRVA 129 Query: 125 GGNLVTARPIGVVEGVDYHHTGEVRRIDRKGIGRLLDERSIVLLSPLGYSPTGEIFNLAC 184 GN VTARP+GV EGVD+ TGEVRR+D GI RLLDE IVLLSPLGYSPTGE+FNL+ Sbjct: 130 SGNFVTARPLGVREGVDFQFTGEVRRVDAPGIVRLLDEGQIVLLSPLGYSPTGEVFNLSG 189 Query: 185 EDVAMRAAIDLEAEKLILYGAEQGLLDASGKLVRELR--------------PQQVPAHLQ 230 EDVA + A+ L+A+KL+ L D +++ +L P+++ AHL+ Sbjct: 190 EDVATQVAVALKADKLVFLTEAGPLRDRQREMLTQLTVSAAERLLTTDSGLPEELAAHLR 249 Query: 231 RLGNSYQAELLDAAAQACRAGVKRSHIVSYTEDGALLSELFTRTGNGTLVAQEQFEQLRE 290 +A C R H+V DG LL ELF+R G GTLV++E E+LR Sbjct: 250 ------------SAVDVCTVHDLRVHLVDRHIDGGLLIELFSRQGIGTLVSREPVERLRA 297 Query: 291 AGIEDVGGLIELIRPLEEQGILVRRSREVLEREIEQFSIVEREGLIIACAALYPIADSEA 350 A ++DVGG+ +LI+PLE +GILVRRSRE LE EI+ F +++ +GLII AALY +++A Sbjct: 298 ATLDDVGGIFDLIQPLESEGILVRRSREHLELEIDCFRVLDADGLIIGTAALYTFPETKA 357 Query: 351 GELACLAVNPEYRHGGRGDELLERIEERARGLGLKTLFVLTTRTAHWFRERGFQPSSVER 410 E+ACLA++PEYR GGRGD++LE +E A G + +FVLTTRT WF+ERG++ + Sbjct: 358 AEIACLALHPEYRGGGRGDQILEHVETLAWRRGHRQVFVLTTRTQQWFQERGYREGQITD 417 Query: 411 LPAARASLYNFQRNSQVFEKSL 432 LP AR +LYN RNS+V K+L Sbjct: 418 LPPARQALYNQARNSKVLVKAL 439 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 551 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 440 Length adjustment: 32 Effective length of query: 400 Effective length of database: 408 Effective search space: 163200 Effective search space used: 163200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_006747000.1 THITH_RS14955 (amino-acid N-acetyltransferase)
to HMM TIGR01890 (argA: amino-acid N-acetyltransferase (EC 2.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01890.hmm # target sequence database: /tmp/gapView.32073.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01890 [M=429] Accession: TIGR01890 Description: N-Ac-Glu-synth: amino-acid N-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-166 541.1 0.4 1.2e-166 540.8 0.4 1.0 1 lcl|NCBI__GCF_000227685.2:WP_006747000.1 THITH_RS14955 amino-acid N-acety Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000227685.2:WP_006747000.1 THITH_RS14955 amino-acid N-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 540.8 0.4 1.2e-166 1.2e-166 3 429 .] 11 439 .. 10 439 .. 0.98 Alignments for each domain: == domain 1 score: 540.8 bits; conditional E-value: 1.2e-166 TIGR01890 3 kwlreaaPyinahrdktlvvglggelvedknlgklvadiallhslGvrlvlvhGarpqieerlakrgrt 71 +w+r+a Pyi ahrd+t+v+++ ge+ ++ +++ l+ dia l++lG r+vlvhGarpqie rl +rg+t lcl|NCBI__GCF_000227685.2:WP_006747000.1 11 DWFRAAVPYIVAHRDRTMVIAIAGEAAQALEFPTLLRDIAQLQALGTRVVLVHGARPQIEARLRERGLT 79 8******************************************************************** PP TIGR01890 72 thyvrGlrvtdeaslelvkeaaGelrlaiearlsmslantpmagsrlsvvsGnfvtarPiGvveGvdye 140 ++y Glrvtd+a+le v +a+G+lrl+ie ls +l n ag+rl+v+sGnfvtarP+Gv eGvd++ lcl|NCBI__GCF_000227685.2:WP_006747000.1 80 PRYAAGLRVTDAAALEAVCDAVGRLRLHIEGLLSRNLGNPGIAGARLRVASGNFVTARPLGVREGVDFQ 148 ********************************************************************* PP TIGR01890 141 htGevrkidaegirrlldersivllsPlgfsvtGeifnlamedvatsvaiklkadklillteedGilda 209 +tGevr++da gi rllde++ivllsPlg+s+tGe+fnl+ edvat+va++lkadkl++lte + d+ lcl|NCBI__GCF_000227685.2:WP_006747000.1 149 FTGEVRRVDAPGIVRLLDEGQIVLLSPLGYSPTGEVFNLSGEDVATQVAVALKADKLVFLTEAGPLRDR 217 ********************************************************************* PP TIGR01890 210 dGklvaelsaqeveslverlee..ettarllsaavkalrgGvarshlvsyaedGallqelftrdGiGtl 276 + ++ ++l+ + +e+l+ + e a l++av+ + r+hlv+ dG ll elf+r+GiGtl lcl|NCBI__GCF_000227685.2:WP_006747000.1 218 QREMLTQLTVSAAERLLTTDSGlpEELAAHLRSAVDVCTVHDLRVHLVDRHIDGGLLIELFSRQGIGTL 286 *************99987643212345999*************************************** PP TIGR01890 277 vskealesireatiddvggilelirPleeqGilvrrsrellereieefsviekdGliigcaalypyaee 345 vs+e +e +r at+ddvggi++li+Ple +Gilvrrsre le ei+ f v++ dGliig aaly+++e lcl|NCBI__GCF_000227685.2:WP_006747000.1 287 VSREPVERLRAATLDDVGGIFDLIQPLESEGILVRRSREHLELEIDCFRVLDADGLIIGTAALYTFPET 355 ********************************************************************* PP TIGR01890 346 evgelaclavsPeardggrGerllkhiedrarqvGlkrlfvlttrtehWfrerGfaeasvdelPearrk 414 +++e+acla++Pe+r+ggrG+++l+h+e+ a G +++fvlttrt++Wf+erG+ e ++ +lP ar+ lcl|NCBI__GCF_000227685.2:WP_006747000.1 356 KAAEIACLALHPEYRGGGRGDQILEHVETLAWRRGHRQVFVLTTRTQQWFQERGYREGQITDLPPARQA 424 ********************************************************************* PP TIGR01890 415 lynyqrrskilvkkl 429 lyn r+sk+lvk l lcl|NCBI__GCF_000227685.2:WP_006747000.1 425 LYNQARNSKVLVKAL 439 ************976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (429 nodes) Target sequences: 1 (440 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.47 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory