Align Ornithine carbamoyltransferase, anabolic; OTCase; EC 2.1.3.3 (characterized)
to candidate WP_006748313.1 THITH_RS09655 ornithine carbamoyltransferase
Query= SwissProt::P11724 (305 letters) >NCBI__GCF_000227685.2:WP_006748313.1 Length = 303 Score = 361 bits (927), Expect = e-104 Identities = 181/300 (60%), Positives = 223/300 (74%), Gaps = 1/300 (0%) Query: 1 MSVRHFLSFMDYSPEELIGLIRRGSELKDLRNRGVLYEPL-KSRVLGMVFEKASTRTRLS 59 M++RHFLSF D S E+ +I+R ELK GV ++ L + + LGM+FEK+STRTR+S Sbjct: 1 MTLRHFLSFSDLSGSEVRTIIQRAIELKRQTRAGVAHDYLLRGKTLGMIFEKSSTRTRVS 60 Query: 60 FEAGMIQLGGQAIFLSPRDTQLGRGEPIGDSARVMSRMLDGVMIRTFAHATLTEFAAHSK 119 FE GM+QLGG A+FLSPRDTQLGRGEPI D+ARV+SRM+D VMIRT+ H + FA H+ Sbjct: 61 FEVGMLQLGGHALFLSPRDTQLGRGEPIEDTARVLSRMVDAVMIRTYEHEKIERFAQHAT 120 Query: 120 VPVINGLSDDLHPCQLLADMQTFHEHRGSIQGKTVAWIGDGNNMCNSYIEAALKFDFQLR 179 VPVINGL+D HP QLLAD+QT+ E RG I G+ VAWIGDGNNMCNSYI AA + F L Sbjct: 121 VPVINGLTDHEHPAQLLADLQTYTEQRGDIGGRRVAWIGDGNNMCNSYILAARQLGFTLA 180 Query: 180 VACPEGYEPKAEFVALAGDRLRVVRDPREAVAGAHLVSTDVWASMGQEDEAAARIALFRP 239 ACPEGY+P V AGD L ++RDP A A LV TDVWASMGQEDE +AR F Sbjct: 181 AACPEGYDPDPGIVKAAGDALELLRDPAAATRDADLVVTDVWASMGQEDEKSARRQAFTG 240 Query: 240 YQVNAALLDGAADDVLFMHCLPAHRGEEISEELLDDPRSVAWDQAENRLHAQKALLELLI 299 + V++ L+ A D LFMHCLPAHR EE++ E+L+ P+SV W++AENRLHAQKAL+E L+ Sbjct: 241 FLVDSELMALARPDALFMHCLPAHREEEVTTEVLEGPQSVVWEEAENRLHAQKALVEFLL 300 Lambda K H 0.322 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 303 Length adjustment: 27 Effective length of query: 278 Effective length of database: 276 Effective search space: 76728 Effective search space used: 76728 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate WP_006748313.1 THITH_RS09655 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00658.hmm # target sequence database: /tmp/gapView.29041.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-124 400.6 0.0 2.3e-124 400.4 0.0 1.0 1 lcl|NCBI__GCF_000227685.2:WP_006748313.1 THITH_RS09655 ornithine carbamoy Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000227685.2:WP_006748313.1 THITH_RS09655 ornithine carbamoyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 400.4 0.0 2.3e-124 2.3e-124 1 303 [. 4 300 .. 4 301 .. 0.98 Alignments for each domain: == domain 1 score: 400.4 bits; conditional E-value: 2.3e-124 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgkeekk.lkgktlaliFekrstRtRvsfevaayelGaqv 68 rh+ls+ dls +e+++++++a +lk+++++g+ +++ l+gktl++iFek+stRtRvsfev++ +lG+++ lcl|NCBI__GCF_000227685.2:WP_006748313.1 4 RHFLSFSDLSGSEVRTIIQRAIELKRQTRAGVAHDYlLRGKTLGMIFEKSSTRTRVSFEVGMLQLGGHA 72 8******************************99876268****************************** PP TIGR00658 69 lylnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDll 137 l+l++ ++qlgr+e+i+Dtarvlsr+vda+++R+y+he++e +a++a+vPvingLtd+ehP q+laDl+ lcl|NCBI__GCF_000227685.2:WP_006748313.1 73 LFLSPRDTQLGRGEPIEDTARVLSRMVDAVMIRTYEHEKIERFAQHATVPVINGLTDHEHPAQLLADLQ 141 ********************************************************************* PP TIGR00658 138 tikeklgklkevklvyvGDannvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggklel 206 t +e+ g++ + +++++GD+nn++ns +laa +lG+++ a+Peg++p++ ivk a g lel lcl|NCBI__GCF_000227685.2:WP_006748313.1 142 TYTEQRGDIGGRRVAWIGDGNNMCNSYILAARQLGFTLAAACPEGYDPDPGIVKAA-------GDALEL 203 *****************************************************998.......789*** PP TIGR00658 207 tedpkkavkdadviytDvwvsmGeeekkeerlkllkpyqvneellelakpevkflhCLPavrGeevtde 275 ++dp+ a++dad+++tDvw+smG+e++k++r +++ ++ v++el++la p++ f+hCLPa+r eevt e lcl|NCBI__GCF_000227685.2:WP_006748313.1 204 LRDPAAATRDADLVVTDVWASMGQEDEKSARRQAFTGFLVDSELMALARPDALFMHCLPAHREEEVTTE 272 ********************************************************************* PP TIGR00658 276 vlegeasivfdeaenRlhaqkavlkall 303 vleg++s+v++eaenRlhaqka++++ll lcl|NCBI__GCF_000227685.2:WP_006748313.1 273 VLEGPQSVVWEEAENRLHAQKALVEFLL 300 ************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (303 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.70 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory