Align Acetolactate synthase small subunit; Short=AHAS; Short=ALS; EC 2.2.1.6 (characterized, see rationale)
to candidate WP_007473039.1 CMTB2_RS00745 acetolactate synthase small subunit
Query= uniprot:A0A154R0Y7 (82 letters) >NCBI__GCF_000170735.1:WP_007473039.1 Length = 153 Score = 62.4 bits (150), Expect = 2e-15 Identities = 30/73 (41%), Positives = 46/73 (63%) Query: 1 MNHTLSILLQNEAGALVRVAGLFAARGYNIDTLTVAATHDPAVSRLTLSLQCDEAALGQI 60 M +S++++NE G L R+ +FAARGYNI +LTVA + SR+T+ + D QI Sbjct: 1 MKRVISVIVENEHGVLARIVNMFAARGYNITSLTVAPIPESEFSRMTIMSEGDPKVFEQI 60 Query: 61 LQQTRKLVDVLQV 73 ++Q KL+ V +V Sbjct: 61 VKQLYKLIPVYKV 73 Lambda K H 0.321 0.130 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 19 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 82 Length of database: 153 Length adjustment: 12 Effective length of query: 70 Effective length of database: 141 Effective search space: 9870 Effective search space used: 9870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 40 (20.0 bits)
Align candidate WP_007473039.1 CMTB2_RS00745 (acetolactate synthase small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00119.hmm # target sequence database: /tmp/gapView.22932.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00119 [M=158] Accession: TIGR00119 Description: acolac_sm: acetolactate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-46 143.1 0.5 4e-46 143.0 0.5 1.0 1 lcl|NCBI__GCF_000170735.1:WP_007473039.1 CMTB2_RS00745 acetolactate synth Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000170735.1:WP_007473039.1 CMTB2_RS00745 acetolactate synthase small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 143.0 0.5 4e-46 4e-46 1 156 [. 1 153 [] 1 153 [] 0.96 Alignments for each domain: == domain 1 score: 143.0 bits; conditional E-value: 4e-46 TIGR00119 1 kkhvlsvlvenepGvLsrvsGlfarrgfniesltvgeteekdlsrmtivvegddkvveqiekqleklvd 69 +k+v+sv+vene GvL+r++ +fa+rg+ni sltv+ e++ srmti+ egd kv eqi kql+kl++ lcl|NCBI__GCF_000170735.1:WP_007473039.1 1 MKRVISVIVENEHGVLARIVNMFAARGYNITSLTVAPIPESEFSRMTIMSEGDPKVFEQIVKQLYKLIP 69 69******************************************************************* PP TIGR00119 70 vlkvldlteseivkrelvlvkvsalgeerneikelteifrgrvvDvsedslivelsgkedkisaflkll 138 v+kv + ++ +++e+++vk ++ e +++i l+ + g++ +v e+ ++v ++ ++d+i+ flk++ lcl|NCBI__GCF_000170735.1:WP_007473039.1 70 VYKVIESDN--FIEKEMAMVKFNLD-EPLSDIDALARCYNGSISNVGEKHVVVSVVDRPDRIDNFLKAV 135 ****87665..6*********9875.679**************************************** PP TIGR00119 139 kefgikevarsGlvalsr 156 k f +ev+rsG+ + r lcl|NCBI__GCF_000170735.1:WP_007473039.1 136 KRFKPLEVVRSGVSVIER 153 ************977665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (158 nodes) Target sequences: 1 (153 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 7.05 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory