Align 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (characterized)
to candidate WP_007473884.1 CMTB2_RS02910 3-isopropylmalate dehydrogenase
Query= BRENDA::P43860 (358 letters) >NCBI__GCF_000170735.1:WP_007473884.1 Length = 354 Score = 390 bits (1002), Expect = e-113 Identities = 205/358 (57%), Positives = 269/358 (75%), Gaps = 10/358 (2%) Query: 1 MQSYNIAVLAGDGIGPEVMAEAIKVLNRVQEKFGFKLNFNEFFVGGAAIEHCGYPLPAET 60 M++Y IAVL GDGIGPE++ EAIKVL+ V EK G FNE+ +GG+A++ P P ET Sbjct: 1 MKTYKIAVLKGDGIGPEIVDEAIKVLDAVAEKEGINFEFNEYLIGGSAVDVFDNPCPDET 60 Query: 61 LKGCDQADAILFGSVGGPKWTNLPPDQQPERGALLPLRKHFKLFCNLRPATLYKGLEKFC 120 +KGC +DAILFGS+GGPKW LP +++PE G LL LRK LF N+RPA ++ L Sbjct: 61 IKGCLNSDAILFGSIGGPKWDKLPKEKRPESG-LLKLRKSLGLFANIRPAIIFDELVNAS 119 Query: 121 PLRADIAAKGFDMVVVRELTGGIYFGQPKGREGDGVQTKAFDTEVYYKYEIERIARAAFE 180 L+ ++ KG D+ VVRELTGGIYFG+P+ ++ + KA++T +Y + EIE+IA AF+ Sbjct: 120 TLKPEVI-KGVDLTVVRELTGGIYFGEPRYKDDN----KAYNTMIYTREEIEKIAHVAFK 174 Query: 181 AAMKRNKKVTSVDKANVLQSSILWRETVTEMAKDYPEVTLEHIYIDNATMQLIKSPESFD 240 A KRNKKVTSVDKANVL+ S LWRE V E+AK+YP+V LEH+Y+DNA MQLI+ P+ FD Sbjct: 175 EASKRNKKVTSVDKANVLEVSELWREVVEEVAKNYPDVELEHMYVDNAAMQLIRDPKQFD 234 Query: 241 VLLCSNIFGDIISDEAAMITGSMGMLPSASLNEEGFGLYEPAGGSAPDIAGKGIANPIAQ 300 V+L NIFGDI+SDEA+MI GS+G+LPSAS+ + GL+EP GSAPDIAG+GIANPIA Sbjct: 235 VILTGNIFGDILSDEASMIVGSIGLLPSASIGGK-VGLFEPIHGSAPDIAGQGIANPIAT 293 Query: 301 ILSAAMMLRYSFNLNEAADAIESAVQKVLASGHRTADLA--DDSTPVSTAEMGTLITQ 356 ILSA+MML Y + +AAD I+ +++KVLA G+RT DL+ D V+T+EMG+LI + Sbjct: 294 ILSASMMLDY-LDEKKAADRIKKSIKKVLADGYRTKDLSSFDAKEIVTTSEMGSLIAE 350 Lambda K H 0.318 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 17 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 354 Length adjustment: 29 Effective length of query: 329 Effective length of database: 325 Effective search space: 106925 Effective search space used: 106925 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_007473884.1 CMTB2_RS02910 (3-isopropylmalate dehydrogenase)
to HMM TIGR00169 (leuB: 3-isopropylmalate dehydrogenase (EC 1.1.1.85))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00169.hmm # target sequence database: /tmp/gapView.940406.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00169 [M=349] Accession: TIGR00169 Description: leuB: 3-isopropylmalate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-162 525.6 0.1 3.1e-162 525.5 0.1 1.0 1 NCBI__GCF_000170735.1:WP_007473884.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000170735.1:WP_007473884.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 525.5 0.1 3.1e-162 3.1e-162 1 346 [. 5 345 .. 5 348 .. 0.97 Alignments for each domain: == domain 1 score: 525.5 bits; conditional E-value: 3.1e-162 TIGR00169 1 kiavLpGDgiGpevvaealkvLkaveerfelklefeealiGGaaidatgePlpeetlkackeadavLlgavGG 73 kiavL+GDgiGpe+v+ea+kvL+av+e++++++ef+e+liGG a+d +P p+et+k+c ++da+L+g++GG NCBI__GCF_000170735.1:WP_007473884.1 5 KIAVLKGDGIGPEIVDEAIKVLDAVAEKEGINFEFNEYLIGGSAVDVFDNPCPDETIKGCLNSDAILFGSIGG 77 79*********************************************************************** PP TIGR00169 74 pkWdnlprdvrPekgLLklrkeldlfanLrPaklfksLeklsplkeeivkgvDlvvvreLtgGiYfGepkere 146 pkWd+lp+++rPe+gLLklrk+l+lfan+rPa +f++L+++s+lk+e++kgvDl vvreLtgGiYfGep+ ++ NCBI__GCF_000170735.1:WP_007473884.1 78 PKWDKLPKEKRPESGLLKLRKSLGLFANIRPAIIFDELVNASTLKPEVIKGVDLTVVRELTGGIYFGEPRYKD 150 **********************************************************************998 PP TIGR00169 147 eaeeekkaldtekYtkeeieriarvafelarkrrkkvtsvDkanvLessrlWrktveeiakeyPdvelehlyi 219 + +ka++t+ Yt+eeie+ia+vaf+ a kr+kkvtsvDkanvLe+s+lWr++vee+ak+yPdveleh+y+ NCBI__GCF_000170735.1:WP_007473884.1 151 D----NKAYNTMIYTREEIEKIAHVAFKEASKRNKKVTSVDKANVLEVSELWREVVEEVAKNYPDVELEHMYV 219 8....79****************************************************************** PP TIGR00169 220 DnaamqLvksPeqldvvvtsnlfGDilsDeasvitGslGlLPsaslsskglalfepvhgsapdiagkgianpi 292 DnaamqL+++P+q+dv++t+n+fGDilsDeas+i+Gs+GlLPsas++ +++lfep+hgsapdiag+gianpi NCBI__GCF_000170735.1:WP_007473884.1 220 DNAAMQLIRDPKQFDVILTGNIFGDILSDEASMIVGSIGLLPSASIG-GKVGLFEPIHGSAPDIAGQGIANPI 291 ***********************************************.6679********************* PP TIGR00169 293 aailsaalllryslnleeaaeaieaavkkvleegkrtedlaseatta.vstkeve 346 a+ilsa+++l y l+ ++aa++i++++kkvl++g+rt+dl s ++++ v+t+e++ NCBI__GCF_000170735.1:WP_007473884.1 292 ATILSASMMLDY-LDEKKAADRIKKSIKKVLADGYRTKDLSSFDAKEiVTTSEMG 345 **********99.68899**********************996655415666665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (354 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 22.33 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory