Align Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 (characterized)
to candidate WP_007474124.1 CMTB2_RS03820 diaminopimelate decarboxylase
Query= SwissProt::B4XMC6 (405 letters) >NCBI__GCF_000170735.1:WP_007474124.1 Length = 402 Score = 456 bits (1173), Expect = e-133 Identities = 225/392 (57%), Positives = 293/392 (74%) Query: 3 NYEELFQTHKTPFYLYDFDKIKQAFLNYKEAFKGRKSLICYALKANSNLSILSLLAHLES 62 N+ E + + TP Y+YDF+ ++ + K+AFK RKS+I YA+KANSNLS++ A L S Sbjct: 2 NFLEFAKKYDTPLYVYDFNHFEKQYNELKQAFKARKSIIAYAIKANSNLSVIKKFASLGS 61 Query: 63 GADCVSIGEIQRALKAGIKPYRIVFSGVGKSAFEIEQALKLNILFLNVESFMELKTIETI 122 GADCVSIGE++RAL AG+ Y+I+FSGVGK EI++AL +IL LNVES ELK I+ I Sbjct: 62 GADCVSIGEVKRALLAGVDKYKIIFSGVGKRDDEIKEALDKDILMLNVESEAELKRIDEI 121 Query: 123 AQSLGIKARISIRINPNIDAKTHPYISTGLKENKFGVGEKEALEMFLWAKKSAFLEPVSV 182 A+S+ +ARISIR+NP+ID KTHPYISTGL ENKFGV + A +M++ AKKS L P+ + Sbjct: 122 AKSMNKEARISIRVNPDIDPKTHPYISTGLSENKFGVDIESAKKMYINAKKSKNLNPIGI 181 Query: 183 HFHIGSQLLDLEPIIEASQKVAKIAKSLIALGIDLRFFDVGGGIGVSYENEETIKLYDYA 242 HFHIGSQL +L PI EAS+ VA + +SL A+ +D++FFD+GGG+G+ Y++EETIK YDYA Sbjct: 182 HFHIGSQLTELNPIKEASEIVANLVRSLKAINVDIKFFDIGGGLGIKYKDEETIKPYDYA 241 Query: 243 QGILNALQGLDLTIICEPGRSIVAESGELITQVLYEKKAQNKRFVIVDAGMNDFLRPSLY 302 Q IL+ L GLD+TIICEPGR +V G +T+VLYEK +KRFVIVD MND +RPSLY Sbjct: 242 QAILSTLSGLDVTIICEPGRFLVGNGGWFLTKVLYEKVNGDKRFVIVDGAMNDLIRPSLY 301 Query: 303 HAKHAIRVITPSKGREISPCDVVGPVCESSDTFLKDAHLPELEPGDKIAIEKVGAYGSSM 362 +A H + VI+ K +IS ++VGPVCES D F KD +P+ PGD I I GAYG +M Sbjct: 302 NAYHKVEVISSVKNPQISKANIVGPVCESGDFFAKDIEVPQTNPGDLIVIHSAGAYGFTM 361 Query: 363 ASQYNSRPKLLELALEDHKIRVIRKREALEDL 394 +S YN+RP+ E+A+ED K RVIR+RE EDL Sbjct: 362 SSNYNTRPRPCEIAIEDGKDRVIRRRETFEDL 393 Lambda K H 0.319 0.138 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 402 Length adjustment: 31 Effective length of query: 374 Effective length of database: 371 Effective search space: 138754 Effective search space used: 138754 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_007474124.1 CMTB2_RS03820 (diaminopimelate decarboxylase)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.14397.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-167 541.2 0.0 6.9e-167 541.1 0.0 1.0 1 lcl|NCBI__GCF_000170735.1:WP_007474124.1 CMTB2_RS03820 diaminopimelate de Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000170735.1:WP_007474124.1 CMTB2_RS03820 diaminopimelate decarboxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 541.1 0.0 6.9e-167 6.9e-167 15 416 .. 2 397 .. 1 398 [. 0.99 Alignments for each domain: == domain 1 score: 541.1 bits; conditional E-value: 6.9e-167 TIGR01048 15 dlkelaeefgtPlYvydeetlrerlealkeafkaeeslvlYAvKAnsnlavlrllaeeGlgldvvsgGE 83 + e a++++tPlYvyd +++++++++lk+afka++s ++YA+KAnsnl+v++ +a++G+g+d+vs GE lcl|NCBI__GCF_000170735.1:WP_007474124.1 2 NFLEFAKKYDTPLYVYDFNHFEKQYNELKQAFKARKSIIAYAIKANSNLSVIKKFASLGSGADCVSIGE 70 567899*************************************************************** PP TIGR01048 84 leralaAgvkaekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgkkarvllRvnpdv 152 ++ral Agv+++ki+fsg+gk+++e+++al+ +i ++nv+s++el++++eiak+++k+ar+++Rvnpd+ lcl|NCBI__GCF_000170735.1:WP_007474124.1 71 VKRALLAGVDKYKIIFSGVGKRDDEIKEALDKDILMLNVESEAELKRIDEIAKSMNKEARISIRVNPDI 139 ********************************************************************* PP TIGR01048 153 daktheyisTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlepfveaaekvvkllee 221 d+kth+yisTGl e+KFG+++e+a+++y a+k+++l+++Gih+HIGSq+++l+p++ea e v++l+++ lcl|NCBI__GCF_000170735.1:WP_007474124.1 140 DPKTHPYISTGLSENKFGVDIESAKKMYINAKKSKNLNPIGIHFHIGSQLTELNPIKEASEIVANLVRS 208 ********************************************************************* PP TIGR01048 222 lkeegieleeldlGGGlgisyeeeeeapdleeyaeklleklekeaelglklklilEpGRslvanagvll 290 lk+ ++++++d+GGGlgi+y++ee ++++++ya+++l++l++ l++++i+EpGR+lv+n+g++l lcl|NCBI__GCF_000170735.1:WP_007474124.1 209 LKAINVDIKFFDIGGGLGIKYKDEE-TIKPYDYAQAILSTLSG-----LDVTIICEPGRFLVGNGGWFL 271 ************************9.************99999.....8******************** PP TIGR01048 291 trVesvKevesrkfvlvDagmndliRpalYeayheiaalkrleeeetetvdvvGplCEsgDvlakdrel 359 t+V ++K ++ ++fv+vD++mndliRp+lY+ayh++ +++++++ + +++++vGp+CEsgD++akd+e+ lcl|NCBI__GCF_000170735.1:WP_007474124.1 272 TKVLYEKVNGDKRFVIVDGAMNDLIRPSLYNAYHKVEVISSVKNPQISKANIVGPVCESGDFFAKDIEV 340 ********************************************************************* PP TIGR01048 360 peveeGdllavasaGAYgasmssnYnsrprpaevlveegkarlirrretledllale 416 p++++Gdl++++saGAYg++mssnYn+rprp+e+++e+gk r+irrret+edl+a e lcl|NCBI__GCF_000170735.1:WP_007474124.1 341 PQTNPGDLIVIHSAGAYGFTMSSNYNTRPRPCEIAIEDGKDRVIRRRETFEDLIACE 397 ******************************************************976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (402 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 9.15 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory