Align lysyltransferase (EC 2.3.2.3); [amino group carrier protein]-L-2-aminoadipate ligase (EC 6.3.2.43); glutamate---[amino group carrier protein] ligase (EC 6.3.2.60) (characterized)
to candidate WP_007691428.1 C447_RS04730 lysine biosynthesis protein LysX
Query= BRENDA::Q5JFW0 (273 letters) >NCBI__GCF_000336675.1:WP_007691428.1 Length = 290 Score = 179 bits (453), Expect = 8e-50 Identities = 104/278 (37%), Positives = 154/278 (55%), Gaps = 15/278 (5%) Query: 1 MRIGITYTVLRREEMAIKERAGEFGEVVM----------LHEDDLLFPGNYDLDVVIIRN 50 M IG+ Y+ +RR+E + E G V L+E F G +D+V+ R Sbjct: 1 MNIGVLYSRIRRDEKLLLSELRERGHEVTKVDVRKLRFDLNEPPAAFEG---VDLVVDRC 57 Query: 51 VSHFKALYTARLFESEGIPTVNSSRLIFEAGDKLFATLRLAGK-VPVPEWKAALSEGGAL 109 ++ ++ Y R ++ GIP VNS+ DK+ +L LAG VP P + A ++ AL Sbjct: 58 LATSRSTYATRFLDAYGIPVVNSAATAEVCADKVKNSLALAGAGVPTPRTEVAFTKDAAL 117 Query: 110 RVPDSLGYPLVSKPVFGSWGRLLAKVNDRDSLEAVLEHRKWMKNPLYGIHYFQEFVEKPG 169 ++ GYP V KPV GSWGRL+AK++ RD+ EA+LEH+ + + + + Y QEFVEKPG Sbjct: 118 ETIEAFGYPCVLKPVIGSWGRLMAKIDSRDAAEAILEHKATLGHYEHKVFYIQEFVEKPG 177 Query: 170 RDIRSYVIGGEFVGAIYRYSNHWITNTARGGKAEPCS-DPEVEELSVKAWEAFGEGALAI 228 RDIR GE V A R S+HW+TN ++G A D E +L +A +A G G L + Sbjct: 178 RDIRVLSTDGEPVAAEARSSDHWLTNASKGADATAFELDDEARDLVARASDAVGGGLLGV 237 Query: 229 DIFESEKGLLVNEVNPNMEFKNAARVTGADMAGKLVEY 266 D+ E+ V+EVN +EFK T D+ ++V++ Sbjct: 238 DLMETGDSYTVHEVNHTVEFKALTEATDVDVPARVVDW 275 Lambda K H 0.319 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 290 Length adjustment: 26 Effective length of query: 247 Effective length of database: 264 Effective search space: 65208 Effective search space used: 65208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory