Align imidazole glycerol-phosphate synthase (EC 4.3.2.10) (characterized)
to candidate WP_008804112.1 KVAR_RS07930 imidazole glycerol phosphate synthase cyclase subunit
Query= BRENDA::Q9SZ30 (592 letters) >NCBI__GCF_000025465.1:WP_008804112.1 Length = 258 Score = 120 bits (300), Expect = 9e-32 Identities = 95/313 (30%), Positives = 148/313 (47%), Gaps = 57/313 (18%) Query: 280 LAKRVIACLDVRTNDKGDLVVTKGDQYDVREQSNENEVRNLGKPVDLAGQYYKDGADEIS 339 LAKR+I CLDVR D V KG Q+ +E+ +G V LA +Y +GADE+ Sbjct: 2 LAKRIIPCLDVR-----DGQVVKGVQF------RNHEI--IGDIVPLAKRYADEGADELV 48 Query: 340 FLNITGFRDFPLGDLPMIQVLRQTSKNVFVPLTVGGGIRDFTDASGRYYSSLEVAAEYFR 399 F +IT D + D + + ++ + +P V GGI+ SLE AA+ Sbjct: 49 FYDITASSDGRVVDKSWVS---RVAEVIDIPFCVAGGIK-----------SLEDAAQILS 94 Query: 400 SGADKISIGSDAVSAAEEFIKSGVKTGKSSLEQISRVYGNQAVVVSIDPRRVYVNHPDDV 459 GADKISI S A++ + + +++ +G Q +VV ID + Sbjct: 95 FGADKISINSPALA------------DPTLITRLADRFGVQCIVVGIDTWF----DAETG 138 Query: 460 PYKVIRVTNPGPNGEEYAWYQCTVSGGREGRPIGAFELAKAVEELGAGEILLNCIDCDGQ 519 Y V + T W + + V++ GAGEI+LN ++ DG Sbjct: 139 KYHVNQYTGDETRTRVTQWE--------------TLDWVEEVQKRGAGEIVLNMMNQDGV 184 Query: 520 GKGFDIDLVKLISDSVGIPVIASSGAGTPDHFSEVFEKTNASAALAAGIFHRKEVPIQSV 579 G+D+ + + +P+IAS GAGT +HF E F N ALAA +FH++ + I + Sbjct: 185 RNGYDLQQLAKVRAVCHVPLIASGGAGTMEHFLEAFRDANVDGALAASVFHKQIINIGEL 244 Query: 580 KEHLQEERIEVRI 592 K +L + +E+R+ Sbjct: 245 KAYLAAQGVEIRV 257 Lambda K H 0.317 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 356 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 592 Length of database: 258 Length adjustment: 30 Effective length of query: 562 Effective length of database: 228 Effective search space: 128136 Effective search space used: 128136 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory