Align arogenate dehydratase (EC 4.2.1.91) (characterized)
to candidate WP_008806116.1 KVAR_RS05455 amino acid ABC transporter substrate-binding protein
Query= BRENDA::Q01269 (268 letters) >NCBI__GCF_000025465.1:WP_008806116.1 Length = 253 Score = 146 bits (368), Expect = 5e-40 Identities = 85/238 (35%), Positives = 127/238 (53%), Gaps = 3/238 (1%) Query: 18 LASASLQAQESRLDRILESGVLRVATTGDYKPFSYRTEEGGYAGFDVDMAQRLAESLGAK 77 LA + AQ + I SG L+V GDY P ++R G G+DVDMA+ L +LG K Sbjct: 11 LAIMTCGAQARDMQTIEHSGELKVGVPGDYAPLAFRNAAGELQGYDVDMARDLGRTLGLK 70 Query: 78 LVVVPTSWPNLMRDFADDRFDIAMSGISINLERQRQAYFSIPYLRDGKTPITLCSEEARF 137 + V TSWP L D D+FDIAM G++ R + S P + +GK + C R Sbjct: 71 VSFVYTSWPALAADLRADKFDIAMGGVTQTPARAKDFALSHPVVANGKIALANCQAAPRL 130 Query: 138 QTLEQIDQPGVTAIVNPGGTNEKFARANLKKARILVHPDNVTIFQQIVDGKADLMMTDAI 197 +L +ID+P V +VNPGGTN+ F ++K+A+I+ +NV + + AD+M+TD I Sbjct: 131 GSLAKIDRPEVKVVVNPGGTNQSFVDEHIKQAQIIRVQNNVDNLEALRQKTADMMVTDLI 190 Query: 198 EARLQSRLHPELCAVHPQQPF--DFAEKAYLLPRDE-AFKRYVDQWLHIAEQSGLLRQ 252 E P + V + PF ++K Y++ +D A V+QWL ++ L R+ Sbjct: 191 EGDYYQSKEPGVFCVANETPFAGTASDKVYMMNKDNPALLEKVNQWLDSQDKEVLKRK 248 Lambda K H 0.322 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 253 Length adjustment: 24 Effective length of query: 244 Effective length of database: 229 Effective search space: 55876 Effective search space used: 55876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory