Align Phosphoserine phosphatase; PSP; EC 3.1.3.3 (characterized)
to candidate WP_008807530.1 KVAR_RS22020 noncanonical pyrimidine nucleotidase, YjjG family
Query= SwissProt::Q72H00 (249 letters) >NCBI__GCF_000025465.1:WP_008807530.1 Length = 225 Score = 75.9 bits (185), Expect = 7e-19 Identities = 46/138 (33%), Positives = 66/138 (47%), Gaps = 1/138 (0%) Query: 107 ELAEAFFRERRRYPLYPEAEAFLAEARRRGLALALLTNGVPDLQREKLVGAGLAHHFSLV 166 EL +AF L A + + + ++TNG LQ+ +L GL HF L+ Sbjct: 81 ELNDAFMNAMAEICAPLPGAVSLLNALQGKVRMGIITNGFTSLQQTRLERTGLRDHFDLL 140 Query: 167 LISGEVGIGKPDPRLFRMALCAFGVAP-EEAAMVGDNPQKDVRGARLAGVRAVWVDRGLR 225 +IS EVG+ KPD R+F AL G P MVGD + D+RG AG+ W++ + Sbjct: 141 IISEEVGVAKPDARIFDYALAQAGNPPRSRVLMVGDTAESDIRGGVNAGLATCWLNAHQQ 200 Query: 226 PEDPEASPDLRVGDLREV 243 + PD V L E+ Sbjct: 201 TLPVDLQPDWTVTSLSEL 218 Lambda K H 0.322 0.140 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 114 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 225 Length adjustment: 23 Effective length of query: 226 Effective length of database: 202 Effective search space: 45652 Effective search space used: 45652 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory