Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate WP_008807867.1 KVAR_RS25010 cystathionine gamma-synthase
Query= SwissProt::P55218 (403 letters) >NCBI__GCF_000025465.1:WP_008807867.1 Length = 386 Score = 250 bits (639), Expect = 4e-71 Identities = 136/337 (40%), Positives = 199/337 (59%), Gaps = 1/337 (0%) Query: 67 YSRYTNPTVRTFEERIAALEGAEQAVATASGMSAILALVMSLCSSGDHVLVSRSVFGSTI 126 YSR NPT + +A LEG AV T +GMSAIL + GD ++ +G + Sbjct: 46 YSRRGNPTRDVVQRALAELEGGAGAVLTNTGMSAILLVTTVFLKPGDLLVAPHDCYGGSY 105 Query: 127 SLFDKYFKRFGIQVDYPPLSDLAAWEAACKPNTKLFFVESPSNPLAELVDIAALAEIAHA 186 LFD KR +V + +D A AA KL VESPSNPL +VDIA + +A Sbjct: 106 RLFDSLAKRGCYRVQFVDQNDEQALRAALAEKPKLVLVESPSNPLLRVVDIAKICGLARE 165 Query: 187 KGALLAVDNCFCTPALQQPLKLGADVVIHSATKYIDGQGRGMGGVV-AGRGEQMKEVVGF 245 GA+ VDN F +PALQ PL LGAD+V+HS TKY++G + GVV A + E+ + Sbjct: 166 AGAVSVVDNTFLSPALQNPLALGADLVLHSCTKYLNGHSDVVAGVVIANDPATVTELAWW 225 Query: 246 LRTAGPTLSPFNAWLFLKGLETLRIRMQAHSASALALAEWLERQPGIERVYYAGLPSHPQ 305 G T F+++L L+GL TL RM+ +ALA+ E+L+ QP ++++Y+ LP + Sbjct: 226 ANNIGVTGGAFDSYLLLRGLRTLSPRMEVAQRNALAIVEYLKTQPLVKKLYHPSLPENQG 285 Query: 306 HELARRQQSGFGAVVSFDVKGGRDAAWRFIDATRMVSITTNLGDTKTTIAHPATTSHGRL 365 HE+A RQQ GFGA++SF++ G RF+ + ++ +LG ++ I+H AT +H + Sbjct: 286 HEIAARQQKGFGAMLSFELDGDEQTLRRFLSGLSLFTLAESLGGVESLISHAATMTHAGM 345 Query: 366 SPEDRARAGIGDSLIRVAVGLEDLDDLKADMARGLAA 402 +PE RA AGI ++L+R++ G+ED +DL AD+ G A Sbjct: 346 APEARAAAGISETLLRISTGIEDGEDLIADLENGFRA 382 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 386 Length adjustment: 31 Effective length of query: 372 Effective length of database: 355 Effective search space: 132060 Effective search space used: 132060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory