Align arogenate dehydrogenase (NADP+) (EC 1.3.1.78) (characterized)
to candidate WP_009543483.1 CCE_RS21000 prephenate dehydrogenase/arogenate dehydrogenase family protein
Query= BRENDA::P73906 (279 letters) >NCBI__GCF_000017845.1:WP_009543483.1 Length = 284 Score = 332 bits (851), Expect = 6e-96 Identities = 161/278 (57%), Positives = 204/278 (73%) Query: 1 MKIGVVGLGLIGASLAGDLRRRGHYLIGVSRQQSTCEKAVERQLVDEAGQDLSLLQTAKI 60 MKIG++GLGLIG SL DLR GH + GVSR++STC++A+ER++VD A +++ L T + Sbjct: 1 MKIGIIGLGLIGGSLGFDLRNCGHIIYGVSRKESTCQRAIEREVVDHASININSLSTVDL 60 Query: 61 IFLCTPIQLILPTLEKLIPHLSPTAIVTDVASVKTAIAEPASQLWSGFIGGHPMAGTAAQ 120 IF+CTPI LI TL++L +L P I+TDV SVKTAI + LWS F+GGHPMAGTA Q Sbjct: 61 IFICTPITLISSTLKQLTSNLRPEVIITDVGSVKTAIVKECEPLWSNFVGGHPMAGTAEQ 120 Query: 121 GIDGAEENLFVNAPYVLTPTEYTDPEQLACLRSVLEPLGVKIYLCTPADHDQAVAWISHL 180 GI+ A++NLF APYV+TPTE T + L + + LG K+Y C+P HDQAVAWISHL Sbjct: 121 GIEAAQKNLFKAAPYVITPTENTPKNSIKILEQLAQSLGSKVYTCSPEIHDQAVAWISHL 180 Query: 181 PVMVSAALIQACAGEKDGDILKLAQNLASSGFRDTSRVGGGNPELGTMMATYNQRALLKS 240 PVMVSA+LI AC GEK+ +L LAQ LASSGF+DTSRVGGGNPELG MMA YN+ LL S Sbjct: 181 PVMVSASLIAACVGEKEKTVLNLAQQLASSGFKDTSRVGGGNPELGLMMAQYNKTGLLHS 240 Query: 241 LQDYRQHLDQLITLISNQQWPELHRLLQQTNGDRDKYV 278 LQ YRQ LD++I I+ ++W L +LL T R ++ Sbjct: 241 LQGYRQQLDEVIEYINREEWDSLEQLLMMTQKKRPPFI 278 Lambda K H 0.318 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 284 Length adjustment: 26 Effective length of query: 253 Effective length of database: 258 Effective search space: 65274 Effective search space used: 65274 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory