Align Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 (characterized)
to candidate WP_009543632.1 CCE_RS20275 triose-phosphate isomerase
Query= SwissProt::Q8XKU1 (248 letters) >NCBI__GCF_000017845.1:WP_009543632.1 Length = 243 Score = 240 bits (612), Expect = 2e-68 Identities = 130/246 (52%), Positives = 164/246 (66%), Gaps = 12/246 (4%) Query: 5 IIAGNWKMHYTIDEAVKLVEELKPLVK--DAKCEVVVCPTFVCLDAVKKAVEGTNIKVGA 62 IIAGNWKMH T EA++ + LK V+ D E+V+C F L + K++ G +++GA Sbjct: 7 IIAGNWKMHKTQGEALEFLTVLKSKVEETDEAREIVLCVPFTTLSILSKSLHGGKVRLGA 66 Query: 63 QNMHFEEKGAFTGEIAPRMLEAMNIDYVIIGHSERREYFNETDETCNKKVKAAFAHNLTP 122 QN+H+E+KGA+TGEI+ ML +++DYV+IGHSERR+YF ETD+T N +V AA H LTP Sbjct: 67 QNIHWEDKGAYTGEISGPMLTELSVDYVVIGHSERRQYFGETDKTANLRVIAAQRHGLTP 126 Query: 123 ILCCGETLEQRENGTTNDVIKAQITADLEGLTKEQAEKVVIAYEPIWAIGTGKTATSDQA 182 ILC GET EQR+ G VI Q+ +GL +VIAYEPIWAIGTG T + +A Sbjct: 127 ILCVGETKEQRDAGEAESVIINQLQ---KGLVDVDQSNLVIAYEPIWAIGTGDTCDATEA 183 Query: 183 NETIAAIRAMVAEMFGQEVADKVRIQYGGSVKPNTIAEQMAKSDIDGALVGGASLVAADF 242 N I IR ++ V IQYGGSVKPN I E MA+SDIDGALVGGASL F Sbjct: 184 NRIIRVIRDQLSN-------KNVTIQYGGSVKPNNIDEIMAQSDIDGALVGGASLDPVSF 236 Query: 243 AQIVNY 248 A+IVNY Sbjct: 237 ARIVNY 242 Lambda K H 0.316 0.131 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 243 Length adjustment: 24 Effective length of query: 224 Effective length of database: 219 Effective search space: 49056 Effective search space used: 49056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
Align candidate WP_009543632.1 CCE_RS20275 (triose-phosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00419.hmm # target sequence database: /tmp/gapView.18847.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-53 167.7 0.2 2.2e-53 167.4 0.2 1.0 1 lcl|NCBI__GCF_000017845.1:WP_009543632.1 CCE_RS20275 triose-phosphate iso Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000017845.1:WP_009543632.1 CCE_RS20275 triose-phosphate isomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 167.4 0.2 2.2e-53 2.2e-53 1 226 [. 7 232 .. 7 234 .. 0.92 Alignments for each domain: == domain 1 score: 167.4 bits; conditional E-value: 2.2e-53 TIGR00419 1 lviinfKlnesvgkvelevaklaeevaseagv.evavappfvdldvvkdeve.seiqvaAqnvdavksG 67 ++ +n+K++ + g+ + ++ l+ +v ++++ e+++ +pf l+++++ ++ +++++Aqn++ ++G lcl|NCBI__GCF_000017845.1:WP_009543632.1 7 IIAGNWKMHKTQGEALEFLTVLKSKVEETDEArEIVLCVPFTTLSILSKSLHgGKVRLGAQNIHWEDKG 75 6899**********************99876438******************99*************** PP TIGR00419 68 aftGeisAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleereaartin 136 a+tGeis ml +l + +v+igHsErR ++ e+d+ + +v ++ gl++++Cvget+e+r+a++ lcl|NCBI__GCF_000017845.1:WP_009543632.1 76 AYTGEISGPMLTELSVDYVVIGHSERRQYFGETDKTANLRVIAAQRHGLTPILCVGETKEQRDAGEAES 144 ***************************************************************988766 PP TIGR00419 137 nvatt.aaaaA...lepdvvAvEPveliGtGkpvskAeaevveksvrdhlkkvskevaesvrvlyGasv 201 ++ ++ ++ ++ v+A+EP+++iGtG + ea+ + +rd l +++v ++yG+sv lcl|NCBI__GCF_000017845.1:WP_009543632.1 145 VIINQlQKGLVdvdQSNLVIAYEPIWAIGTGDTCDATEANRIIRVIRDQL------SNKNVTIQYGGSV 207 665541222223448999*****************************655......5899********* PP TIGR00419 202 taaedaelaaqldvdGvLlasavlk 226 + ++ e +aq d+dG+L+++a+l lcl|NCBI__GCF_000017845.1:WP_009543632.1 208 KPNNIDEIMAQSDIDGALVGGASLD 232 **********************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (243 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.61 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory