Align D-3-phosphoglycerate dehydrogenase; PGDH; EC 1.1.1.95 (uncharacterized)
to candidate WP_009544404.1 CCE_RS07570 2-hydroxyacid dehydrogenase
Query= curated2:O29445 (527 letters) >NCBI__GCF_000017845.1:WP_009544404.1 Length = 337 Score = 131 bits (330), Expect = 3e-35 Identities = 82/269 (30%), Positives = 138/269 (51%), Gaps = 13/269 (4%) Query: 58 IQAAKNLKIIGRAGVGVDNIDINAATQRGIVVVNAPGGNTISTAEHAIALMLAAARKIPQ 117 I A + ++I G + ID AA++ G+ VV P + + AEHA+ L+L RK+ + Sbjct: 65 ILAEQGTELIALRCAGYNMIDAQAASELGLRVVRVPAYSPYAVAEHAVGLILMLNRKLNK 124 Query: 118 ADRSVKEGKWERKKFMGIELRGKTAGVIGLGRVGFEVAKRCKALEMNVLAYDPFVSKERA 177 A V++ + +G +L T GVIG G +G A+ + ++L YD +++ Sbjct: 125 AYNRVRDDNFTLDGLLGFDLHKSTVGVIGTGNIGTIFAQIMQGFGCHLLGYDVNPNEDFT 184 Query: 178 EQIGVKLVDFDTLLASSDVITVHVPRTKETIGLIGKGQFEKMKDGVIVVNAARGGIVDEA 237 G K VD LLA SD+I++H P T LI + ++MK GV+++N +RG +V+ Sbjct: 185 AIAGAKYVDLPELLAKSDIISLHCPLVPSTYHLINQETIQQMKQGVMLINTSRGQLVNTR 244 Query: 238 ALYEAIKAGKVAAAALDVYEKEP----PSPDNPLLKLD---------NVVTTPHIAASTR 284 A+ + IK+G++ LDVYE+E N +++ D NVV T H A T+ Sbjct: 245 AVIDGIKSGRIGYVGLDVYEEEDELFFEDHSNNIIQDDTFQLLQSFQNVVITAHQAFFTK 304 Query: 285 EAQLNVGMIIAEDIVNMAKGLPVRNAVNL 313 +A + + +I + +G + N V + Sbjct: 305 DALIAIAQTTIANISSWEQGNELINEVKV 333 Lambda K H 0.317 0.136 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 527 Length of database: 337 Length adjustment: 32 Effective length of query: 495 Effective length of database: 305 Effective search space: 150975 Effective search space used: 150975 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory