Align branched-chain-amino-acid transaminase (EC 2.6.1.42); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate WP_009544417.1 CCE_RS07635 branched-chain amino acid transaminase
Query= BRENDA::P54691 (305 letters) >NCBI__GCF_000017845.1:WP_009544417.1 Length = 304 Score = 493 bits (1268), Expect = e-144 Identities = 234/301 (77%), Positives = 274/301 (91%) Query: 1 MHKFLPIAYFEDKFVPFEDAKISVATHALHYGTAAFGGLRGIPDPEDPGTILLFRLDRHG 60 MH FLPIAYFE++FVPFE+AK+S+ATHALHYGTAAFGG+RGIPDPE+P ILLFRLDRH Sbjct: 1 MHTFLPIAYFENQFVPFENAKLSIATHALHYGTAAFGGMRGIPDPENPKQILLFRLDRHC 60 Query: 61 DRLSKSAKFLHYDISAEKIKEVIVDFVKKNQPDKSFYIRPLVYSSGLGIAPRLHNLEKDF 120 RLS+SAKFL+Y++S+EK++++I+DFVKKN+P +SFYIRPLVYSSGLGIAPRLHN+EK+F Sbjct: 61 QRLSQSAKFLNYELSSEKLQQIIIDFVKKNKPSQSFYIRPLVYSSGLGIAPRLHNIEKNF 120 Query: 121 LVYGLEMGDYLAADGVSCRISSWYRQEDRSFPLRGKISAAYITSALAKTEAVESGFDEAI 180 VYGLEMGDYL+ DG+SCRISSW RQEDRSFPLRGKISAAYITSALAKTEAVESGFDEAI Sbjct: 121 FVYGLEMGDYLSPDGISCRISSWTRQEDRSFPLRGKISAAYITSALAKTEAVESGFDEAI 180 Query: 181 LMNSQGKVCEATGMNVFMVRNGQIVTPGNEQDILEGITRDSILTIAADLGIPTCQRPIDK 240 LMNSQGKVCEATGMN+F++RNG ++TPG EQDILEGITRDS+LT+A + GIPT +RPIDK Sbjct: 181 LMNSQGKVCEATGMNIFIIRNGTLITPGFEQDILEGITRDSVLTLAKNFGIPTIERPIDK 240 Query: 241 SELMIADEVFLSGTAAKITPVKRIENFTLGGDRPITEKLRSVLTAVTENREPKYQDWVFK 300 SEL IADEVFL GTAAKI PVK+IE F L RPITEKL+ L A+TEN++P Y+DWV+ Sbjct: 241 SELFIADEVFLCGTAAKIAPVKQIETFKLSAHRPITEKLKDKLFAITENKDPDYRDWVYT 300 Query: 301 I 301 + Sbjct: 301 V 301 Lambda K H 0.320 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 391 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 304 Length adjustment: 27 Effective length of query: 278 Effective length of database: 277 Effective search space: 77006 Effective search space used: 77006 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory