Align D-3-phosphoglycerate dehydrogenase; PGDH; EC 1.1.1.95 (uncharacterized)
to candidate WP_009544749.1 CCE_RS12115 2-hydroxyacid dehydrogenase
Query= curated2:O27051 (525 letters) >NCBI__GCF_000017845.1:WP_009544749.1 Length = 332 Score = 190 bits (483), Expect = 6e-53 Identities = 114/324 (35%), Positives = 181/324 (55%), Gaps = 15/324 (4%) Query: 5 KVLIADSINEKGISELEEVAEVVVNTT---ITPEELLDAIKDFDAIVVRSRTKVTREVIE 61 KV+I ++ + I L E+++N T +T EE+++ KD ++V + +E Sbjct: 6 KVVITHWVHPEIIDYLTPHCELILNQTKETLTREEVINRSKDAQGLMVFMPDYIDVNFLE 65 Query: 62 AAPRLKIIARAGVGVDNVDVKAATDRGIMVINAPESTSITVAEHSIGLMLALARKIAIAD 121 A P+LK+I+ A G DN DV+A T R I P+ + AE +IGL+L LAR++ D Sbjct: 66 ACPQLKVISGALRGYDNFDVEACTKRNIWFTIVPDLLAAPTAELTIGLLLILARRMVEGD 125 Query: 122 RSVKEGKWE--KNRFMGIELNGKTLGIIGMGRIGSQVVVRTKAFGMDIMVYDPY-ISKEA 178 R ++ G ++ K + L KTLGIIGMG++G + R F M ++ +D ++ + Sbjct: 126 RLIRSGNFQGWKPQLYSTGLLNKTLGIIGMGKLGKALTKRLMGFDMTLLYHDKITLTSQQ 185 Query: 179 AEEMGVTVTDLETLLRESDIVTIHVPLTPETRHLISEDEFKLMKDTAFIVNCARGGIIDE 238 + +T T LE LL +SD V + VPL P+T HLI+E+ K+MK +F++N RG I+DE Sbjct: 186 ERDWKITKTSLEELLTKSDYVVLMVPLVPDTYHLINENSLKMMKPNSFLINPCRGSIVDE 245 Query: 239 DALYRALKDGEIAGAALDVFEEEP------PEG---SPLLELENVVLTPHIGASTSEAQR 289 A+ A+K G +AG A DVFE E P+ + L ++ + TPH+G++ +E +R Sbjct: 246 TAVATAIKSGHLAGYAADVFEMEDWAIANRPQSINQTLLTDINHTFFTPHLGSAVNEVRR 305 Query: 290 DAAIIVANEIKTVFQGGAPRNVLN 313 D A+ A I V P+ +N Sbjct: 306 DIALEAAKNIIEVLSENRPQGAVN 329 Lambda K H 0.316 0.135 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 525 Length of database: 332 Length adjustment: 31 Effective length of query: 494 Effective length of database: 301 Effective search space: 148694 Effective search space used: 148694 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory