Align Histidine biosynthesis trifunctional protein; EC 3.5.4.19; EC 3.6.1.31; EC 1.1.1.23 (characterized)
to candidate WP_009544987.1 CCE_RS10955 histidinol dehydrogenase
Query= SwissProt::P00815 (799 letters) >NCBI__GCF_000017845.1:WP_009544987.1 Length = 434 Score = 238 bits (607), Expect = 5e-67 Identities = 143/409 (34%), Positives = 211/409 (51%), Gaps = 10/409 (2%) Query: 383 EIMHLVNPIIENVRDKGNSALLEYTEKFDGVKLSNPVLNAPFPEEYFEG---LTEEMKEA 439 +++ + +I + G+ L++Y +KFD + + PEE+ + + E+K+A Sbjct: 28 QVIPIAQEVITAIAQTGDKGLIQYAQKFDYAGATPENIKVT-PEEFDQAQHLVEPEVKKA 86 Query: 440 LDLSIENVRKFHAAQLPTETLEVETQPGVLCSRFPRPIEKVGLYIPGGTAILPSTALMLG 499 +D + N+++ H QLP E E G+ PI VGLY+P G PS LML Sbjct: 87 VDQAFRNIKEVHQRQLPEEMNLAEIDTGIFAGEKITPIPSVGLYVPRGKGAFPSMMLMLT 146 Query: 500 VPAQVAQCKEIVFASPPRKSDGKVSPEVVYVAEKVGASKIVLAGGAQAVAAMAYGTETIP 559 +PA VA K+IV +PP K +G V P +YVA+ G +++ GG QA+AAMA GT T+P Sbjct: 147 IPAMVAGVKQIVVCTPPDK-EGNVEPVSLYVAQMAGVTEVYKLGGIQALAAMALGTATVP 205 Query: 560 KVDKILGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSEVLVIADEDADVDFVASDLLSQA 619 KVDK+ GP + + AAK + + +PAGPSE +V+ADE D A DLL +A Sbjct: 206 KVDKLTGPCSIYGAAAKRVLFGTVD----VGLPAGPSESIVLADETTDPQLAALDLLIEA 261 Query: 620 EHGIDSQVILVGVNLS-EKKIQEIQDAVHNQALQLPRVDIVRKCIAHSTIVLCDGYEEAL 678 EHG DS +LV + + +K + D + Q R A+ I+L EE+L Sbjct: 262 EHGSDSAALLVTHSEAVAEKASQFADEYLKKLPQWRREFCQIGLDAYGGIILTSSLEESL 321 Query: 679 EMSNQYAPEHLILQIANANDYVKLVDNAGSVFVGAYTPESCGDYSSGTNHTLPTYGYARQ 738 N YAPEHL + + + V + NAG + +G YTP S Y+ G N LPT G+AR Sbjct: 322 NFVNDYAPEHLEVLVDDPLRLVGAIQNAGEILLGKYTPSSAATYAIGVNAVLPTGGFARS 381 Query: 739 YSGANTATFQKFITAQNITPEGLENIGRAVMCVAKKEGLDGHRNAVKIR 787 YS + F K T +T +G + + +A E H A+ R Sbjct: 382 YSAVSVYDFLKRSTVAYLTSQGFDRVKETSQTLAHYEEFPAHGMAITER 430 Lambda K H 0.315 0.133 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 745 Number of extensions: 41 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 799 Length of database: 434 Length adjustment: 37 Effective length of query: 762 Effective length of database: 397 Effective search space: 302514 Effective search space used: 302514 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory