Align 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; EC 5.3.1.16; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (uncharacterized)
to candidate WP_009546775.1 CCE_RS01335 imidazole glycerol phosphate synthase subunit HisF
Query= curated2:Q2S296 (258 letters) >NCBI__GCF_000017845.1:WP_009546775.1 Length = 264 Score = 115 bits (287), Expect = 1e-30 Identities = 69/218 (31%), Positives = 121/218 (55%), Gaps = 12/218 (5%) Query: 4 VIPAIDIRDGRCVRLHQGDYDNETVYFEDPVKMAKLWRVQNAQTLHVVDLDAARGEGEHN 63 ++P +D+ GR V+ G + DPV++AK++ A L +D+ A + + Sbjct: 6 ILPCLDVNAGRVVK---GVNFVDLQDAGDPVELAKVYNDAGADELVFLDITATHEQRDTI 62 Query: 64 RDVIGKMCDALDIPIQLGGGIRSMDQIEAALDRGVYRVILGTAAVRNPDFVERAVEQFSA 123 DV+ + + + IP+ +GGGI +++QI+ L G +V + ++AV+NP F+ +A ++F Sbjct: 63 IDVVYRTAEVVFIPLTVGGGISTLEQIKLLLRAGADKVSVNSSAVKNPSFINQASDRFGK 122 Query: 124 RRVVVSIDAR--------DGEVRVQGWTEGSGLDAVAFAKDMEQRGVRRLVYTDISRDGT 175 + +VV+IDA+ +V ++G E +GLDAV +A +ME+RG L+ T + DGT Sbjct: 123 QCIVVAIDAKRRNDPNRPGWDVYIRGGRENTGLDAVKWAVEMEKRGAGELLITSMDADGT 182 Query: 176 MDGPNIQAYRTLGRQLAHAKVTASGGVGEHDDLLDIQT 213 G ++ RT+ Q+ V ASGG G + + T Sbjct: 183 QAGYDLDLTRTIAEQV-EIPVIASGGAGNCQHIYEALT 219 Score = 28.9 bits (63), Expect = 1e-04 Identities = 17/66 (25%), Positives = 30/66 (45%) Query: 32 DPVKMAKLWRVQNAQTLHVVDLDAARGEGEHNRDVIGKMCDALDIPIQLGGGIRSMDQIE 91 D VK A + A L + +DA + ++ D+ + + ++IP+ GG + I Sbjct: 156 DAVKWAVEMEKRGAGELLITSMDADGTQAGYDLDLTRTIAEQVEIPVIASGGAGNCQHIY 215 Query: 92 AALDRG 97 AL G Sbjct: 216 EALTEG 221 Lambda K H 0.321 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 258 Length of database: 264 Length adjustment: 25 Effective length of query: 233 Effective length of database: 239 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory