Align aspartate semialdehyde dehydrogenase (EC 1.2.1.11) (characterized)
to candidate WP_009546785.1 CCE_RS01390 aspartate-semialdehyde dehydrogenase
Query= metacyc::AT1G14810-MONOMER (375 letters) >NCBI__GCF_000017845.1:WP_009546785.1 Length = 347 Score = 352 bits (904), Expect = e-102 Identities = 174/336 (51%), Positives = 241/336 (71%), Gaps = 8/336 (2%) Query: 40 SLAVVGVTGAVGQEFLSVLSDRDFPYSSIKMLASKRSAGKRVAFDGHEYTVEELTADSFN 99 ++A++G TGAVG E L +L R+FP +++K+LAS RSAG + F G VE + +F+ Sbjct: 6 NVAILGATGAVGTELLELLESRNFPLNNLKLLASSRSAGTHLKFKGESIKVEAVDEKAFD 65 Query: 100 GVDIALFSAGGSISKEFGPLAAEKGTIVVDNSSAFRMVDGVPLVIPEVNPEAMKGIKVGM 159 VD+ L SAGGS SK + + G ++VDNSSAFRM VPL++PE+NPEA + Sbjct: 66 DVDLVLASAGGSTSKAWAQTIVDSGAVMVDNSSAFRMNPDVPLIVPEINPEAAANHQ--- 122 Query: 160 GKGALIANPNCSTIICLMAVTPLHHHAKVKRMVVSTYQAASGAGAAAMEELVQQTREVLE 219 +IANPNC+TI+ +A+ PLH ++R+VVSTYQ+ASGAGA AMEE+ Q++ +L+ Sbjct: 123 ---GIIANPNCTTILMAVAIYPLHQVQPIERIVVSTYQSASGAGARAMEEVKIQSQAILK 179 Query: 220 GKPPTCNIFGQQYAFNLFSHNAPILDNGYNEEEMKLVKETRKIWNDTEVKVTATCIRVPV 279 G+ P I AFNLF HN+P+ + GY EEEMK+V ETRKI+N +K+TATC+RVPV Sbjct: 180 GEDPKAEILPYPLAFNLFPHNSPLTETGYCEEEMKMVNETRKIFNTPHLKITATCVRVPV 239 Query: 280 MRAHAESVNLQFENPLDENTAREILKKAPGVYIIDDRASNTFPTPLDVSNKDDVAVGRIR 339 +RAH+E++NL+F+ P AREI+ ++PGV +++D N FP P+D S KDDV VGRIR Sbjct: 240 LRAHSEAINLEFKAPFSVAQAREIIAQSPGVQLLEDWQKNYFPMPIDASGKDDVLVGRIR 299 Query: 340 RDVSQDGNFGLDIFVCGDQIRKGAALNAVQIAEMLL 375 +D+S GL++++CGDQIRKGAALNAVQIAE+L+ Sbjct: 300 QDISDPN--GLELWICGDQIRKGAALNAVQIAELLM 333 Lambda K H 0.318 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 322 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 347 Length adjustment: 29 Effective length of query: 346 Effective length of database: 318 Effective search space: 110028 Effective search space used: 110028 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_009546785.1 CCE_RS01390 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01296.hmm # target sequence database: /tmp/gapView.32593.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01296 [M=339] Accession: TIGR01296 Description: asd_B: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-131 422.6 0.0 6.2e-131 422.4 0.0 1.0 1 lcl|NCBI__GCF_000017845.1:WP_009546785.1 CCE_RS01390 aspartate-semialdehy Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000017845.1:WP_009546785.1 CCE_RS01390 aspartate-semialdehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 422.4 0.0 6.2e-131 6.2e-131 1 338 [. 6 334 .. 6 335 .. 0.99 Alignments for each domain: == domain 1 score: 422.4 bits; conditional E-value: 6.2e-131 TIGR01296 1 nvaivGatGavGqellkvLeernfpidklvllasersaGkkvkfkgkeleveeaekesfegidialfsa 69 nvai+GatGavG ell++Le rnfp+++l+llas+rsaG+++kfkg+ ++ve+++++ f+++d+ l sa lcl|NCBI__GCF_000017845.1:WP_009546785.1 6 NVAILGATGAVGTELLELLESRNFPLNNLKLLASSRSAGTHLKFKGESIKVEAVDEKAFDDVDLVLASA 74 79******************************************************************* PP TIGR01296 70 GgsvskefapkaakagviviDntsafrldedvPLvvpevnaeelkeakkkgiianPnCstiqlvvvLkp 138 Ggs+sk++a ++ +g++++Dn+safr+++dvPL+vpe+n e ++++ giianPnC+ti + v++ p lcl|NCBI__GCF_000017845.1:WP_009546785.1 75 GGSTSKAWAQTIVDSGAVMVDNSSAFRMNPDVPLIVPEINPEAAANHQ--GIIANPNCTTILMAVAIYP 141 ********************************************9999..******************* PP TIGR01296 139 lkdeaklkrvvvstYqavsGaGkkgveeLknqtkavlegkekepeidalkakkfakqiafnaiplidkl 207 l++ ++r+vvstYq+ sGaG++++ee+k q +a+l+g++ ka+ ++++afn++p+ l lcl|NCBI__GCF_000017845.1:WP_009546785.1 142 LHQVQPIERIVVSTYQSASGAGARAMEEVKIQSQAILKGEDP-------KAEILPYPLAFNLFPHNSPL 203 *************************************98764.......5899**************** PP TIGR01296 208 kedGytkeelkllfetrkilgiedlkvsatcvrvPvftghsesvsiefekelsveevkelLkeapgvvv 276 +e Gy +ee+k+++etrki+++++lk++atcvrvPv+++hse++++ef+ ++sv +++e++ ++pgv++ lcl|NCBI__GCF_000017845.1:WP_009546785.1 204 TETGYCEEEMKMVNETRKIFNTPHLKITATCVRVPVLRAHSEAINLEFKAPFSVAQAREIIAQSPGVQL 272 ********************************************************************* PP TIGR01296 277 iddpsenlyptPleavgkdevfvgrirkDlskekglalfvvaDnlrkGaalnavqiaellik 338 ++d ++n +p+P++a+gkd+v+vgrir+D+s+ +gl+l++ +D++rkGaalnavqiaell++ lcl|NCBI__GCF_000017845.1:WP_009546785.1 273 LEDWQKNYFPMPIDASGKDDVLVGRIRQDISDPNGLELWICGDQIRKGAALNAVQIAELLME 334 **********************************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (339 nodes) Target sequences: 1 (347 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.59 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory