Align phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) (characterized)
to candidate WP_009547280.1 CCE_RS18350 nucleoside triphosphate pyrophosphohydrolase
Query= metacyc::MONOMER-21148 (267 letters) >NCBI__GCF_000017845.1:WP_009547280.1 Length = 277 Score = 179 bits (455), Expect = 4e-50 Identities = 96/258 (37%), Positives = 150/258 (58%), Gaps = 7/258 (2%) Query: 7 SLARLTDVIDRLLAPEG-CPWDKEQTPESLCDYLVEECFELVEAIRSGNADEVREEMGDV 65 +L L DV+ +L +P+G CPWD QTP++L Y++EE +E+V AIRS + + EE+GD+ Sbjct: 18 ALNHLIDVVAKLRSPDGGCPWDLAQTPQTLIPYVIEEAYEVVHAIRSDDQKAIVEELGDL 77 Query: 66 MFLLAFLGRLYADKGAFTLDDAMANNAAKMIRRHPHVFSDTTYADRDEFLRNWESIKRAE 125 + + ++ D G F+L + K+IRRHPHVF D + +E +NW+ IK E Sbjct: 78 LLQVVLQAQIAQDYGYFSLQEVAEGITEKLIRRHPHVFGDVAVENSEEVRQNWDKIKAEE 137 Query: 126 KADAEGEPQGVYDSLP---ASLPPLLKAYRIHSKAARVGFTWPEDEDVERQVEAEWLELL 182 K + Q + L SLPPL+ + +I KAA+ GF W + V + E E Sbjct: 138 KGETLEMAQLLSRKLERYNRSLPPLMASSKISVKAAKAGFEWENVDGVWEKFSEELTEFK 197 Query: 183 DVLAGDDKAAQENELGDLIFSLVELGRRKGIKANTALDMTNLKFLRRFRRMEALARERGL 242 + L D+K Q++ELGDL+F+++ + R G+ A+ AL TN +F++R +ME A Sbjct: 198 ESLETDNKVHQQSELGDLLFTIINIARWYGLDASEALSGTNKRFIQRLSKMEKFADRPLT 257 Query: 243 DFPALSLDDKDELWNEAK 260 D+ SL+D ++LW +AK Sbjct: 258 DY---SLEDLEKLWQQAK 272 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 277 Length adjustment: 25 Effective length of query: 242 Effective length of database: 252 Effective search space: 60984 Effective search space used: 60984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory