Align acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17] (characterized)
to candidate WP_009547763.1 CCE_RS14630 aspartate aminotransferase family protein
Query= reanno::azobra:AZOBR_RS19025 (389 letters) >NCBI__GCF_000017845.1:WP_009547763.1 Length = 422 Score = 311 bits (798), Expect = 2e-89 Identities = 171/388 (44%), Positives = 236/388 (60%), Gaps = 12/388 (3%) Query: 5 VMPTYARADIVFERGEGPYLYATDGRRFLDFAAGVAVNVLGHANPYLVEALTAQAHKLWH 64 VM TY R I +RGEG L+ T G+ +LDF AG+A LGH +P LV+ ++ Q L H Sbjct: 23 VMHTYGRFPIAIDRGEGCRLWDTKGKEYLDFVAGIATCTLGHGHPALVKTVSEQIQSLHH 82 Query: 65 TSNLFRVAGQESLAKRLTEATFADTVFFTNSGAEAWECGAKLIRKYHYEKGD-KARTRII 123 SNL+ + Q LA+ + E + AD VFF NSGAEA E KLIRKY + D + I+ Sbjct: 83 VSNLYYIPQQGELAQWMIEHSCADKVFFCNSGAEANEAAIKLIRKYSHTVLDFLEQPVIL 142 Query: 124 TFEQAFHGRTLAAVSAAQQEKLIKGFGPLLDGFDLVPFGDLEAVRNAVTD------ETAG 177 T + +FHGRTLA ++A Q K + F PL+ GF VP+ D++A+ +A+ D A Sbjct: 143 TAKASFHGRTLATITATGQPKYQQDFEPLMPGFAYVPYNDIKAIEHAIADIDEGNRRVAA 202 Query: 178 ICLEPIQGEGGIRAGSVEFLRGLREICDEHGLLLFLDEIQCGMGRTGKLFAHEWAGITPD 237 I LEP+QGEGG+R G +E+ LR+ICDE+ +LL DE+Q G+GR+GKL+ +E G+ PD Sbjct: 203 IMLEPLQGEGGVRPGEIEYFLRLRKICDENNILLVFDEVQVGVGRSGKLWGYENLGVEPD 262 Query: 238 VMAVAKGIGGGFPLGACLATEKAASGMTAGTHGSTYGGNPLATAVGNAVLDKVLEPGFLD 297 V+ AKG+ GG P+GA + E + +T GTH ST+GGNPLA A VL + E L Sbjct: 263 VLTSAKGLAGGIPIGAMMCKE-FCNVLTPGTHASTFGGNPLACAAALTVLKTIEEENILQ 321 Query: 298 HVQRIGGLLQDRLAGLVAENPAVFKGVRGKGLMLGLACGPAVG----DVVVALRANGLLS 353 +VQ G L+ RL + ++P +F VRG GL+ GL + D+V A GLL Sbjct: 322 NVQARGEQLRTRLRAIAQKDPTLFTDVRGWGLINGLEINEEMSITSIDIVKAAMEEGLLL 381 Query: 354 VPAGDNVVRLLPPLNIGEAEVEEAVAIL 381 PAG V+R +PPL + E E+ +A +L Sbjct: 382 APAGPKVLRFVPPLIVTEEEINQAADLL 409 Lambda K H 0.321 0.139 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 422 Length adjustment: 31 Effective length of query: 358 Effective length of database: 391 Effective search space: 139978 Effective search space used: 139978 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory