Align acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17] (characterized)
to candidate WP_009562813.1 AFE_RS01930 aspartate aminotransferase family protein
Query= reanno::azobra:AZOBR_RS19025 (389 letters) >NCBI__GCF_000021485.1:WP_009562813.1 Length = 388 Score = 317 bits (811), Expect = 5e-91 Identities = 177/382 (46%), Positives = 236/382 (61%), Gaps = 7/382 (1%) Query: 5 VMPTYARADIVFERGEGPYLYATDGRRFLDFAAGVAVNVLGHANPYLVEALTAQAHKLWH 64 +M TYAR + F RGEG +LY T+GRR+LD AG+AV LGH++P + AL QA +L H Sbjct: 3 LMSTYARLPVAFARGEGVWLYDTEGRRYLDALAGIAVCGLGHSHPAVTRALQTQAGQLLH 62 Query: 65 TSNLFRVAGQESLAKRLTEATFADTVFFTNSGAEAWECGAKLIRKYHYEKGDKARTRIIT 124 TSNL+R+ QE L+ L + D FF NSGAEA E K+ R + + KG A +I+ Sbjct: 63 TSNLYRIPAQEKLSDTLCAVSGMDAAFFCNSGAEANEAAIKIARLHGHGKG-IAEPQILV 121 Query: 125 FEQAFHGRTLAAVSAAQQEKLIKGFGPLLDGFDLVPFGDLEAVRNAVTDETAGIC---LE 181 F AFHGRTLA ++A ++ +GF PLL GF P+GDL VR A+ GIC E Sbjct: 122 FSNAFHGRTLATLTATGNFRIQEGFSPLLPGFVRAPYGDLSTVR-ALVQANPGICAILAE 180 Query: 182 PIQGEGGIRAGSVEFLRGLREICDEHGLLLFLDEIQCGMGRTGKLFAHEW-AGITPDVMA 240 P+QGEGG+R FL GLRE+CD HGLLL LDE+Q G+GRTG FA++ G+ PDV++ Sbjct: 181 PLQGEGGVRPAPEGFLTGLREVCDAHGLLLMLDEVQTGIGRTGAFFAYQQIPGLRPDVLS 240 Query: 241 VAKGIGGGFPLGACLATEKAASGMTAGTHGSTYGGNPLATAVGNAVLDKVLEPGFLDHVQ 300 +AKG+G G P+GA LA + A+ G HG+T+GG PL A AVLD + + H Sbjct: 241 LAKGLGNGVPIGAMLAGQSTAALFGPGKHGTTFGGGPLVCAAAQAVLDTMQQEDLPAHAG 300 Query: 301 RIGGLLQDRLAGLVAENPAVFKGVRGKGLMLGLACGPAVGDVVVALRANGLLSVPAGDNV 360 R+G LL+ RL + +P V + +RG GLM+G+ +V GLL + V Sbjct: 301 RMGALLRQRLQKRLGGHPEVLE-IRGMGLMVGIELAHKPERLVERALEAGLLINVTAEKV 359 Query: 361 VRLLPPLNIGEAEVEEAVAILA 382 +RLLPPL + EAE++ VA LA Sbjct: 360 IRLLPPLILQEAEIDLLVAGLA 381 Lambda K H 0.321 0.139 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 460 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 388 Length adjustment: 30 Effective length of query: 359 Effective length of database: 358 Effective search space: 128522 Effective search space used: 128522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory