Align argininosuccinate lyase (EC 4.3.2.1) (characterized)
to candidate WP_010875908.1 MTH_RS01240 argininosuccinate lyase
Query= BRENDA::Q8DVX5 (460 letters) >NCBI__GCF_000008645.1:WP_010875908.1 Length = 468 Score = 342 bits (878), Expect = 1e-98 Identities = 195/459 (42%), Positives = 277/459 (60%), Gaps = 10/459 (2%) Query: 8 LWGGRFEAGLAQWVEEFGASISFDQKLAEFDLKGSIAHVTMLGEKGIISQEDAATIKAGL 67 L GR +G+ EF +S++FD + E D++ ++AH ML +GII +E AA I L Sbjct: 3 LRAGRLNSGMEDEAAEFTSSLTFDHHIFEADIECNMAHTRMLAHEGIIPEEVAAKIIDAL 62 Query: 68 EDLLEEYKAGQLKFDVSNEDIHMNMESLLTAKIGPVAGKLHTARSRNDQVATDMHLYLKA 127 E L EE L D S EDIHM +E+ +TA+IG AG +HT +SRNDQVATD+ L L+ Sbjct: 63 ESLREE-GIEALDMDPSVEDIHMAVENYVTARIGEEAGFMHTGKSRNDQVATDLRLALRE 121 Query: 128 KLDEVIEKLANLRTVLVDLADKHVHTIMPGYTHLQHAQPISFGHHLMAYYNMFTRDSERF 187 ++ + +L + + DLA H T+M GYTHLQHAQP + GHHLMAY + RD ER Sbjct: 122 RIRTISRELLDFIDSISDLALDHTETVMVGYTHLQHAQPTTLGHHLMAYASSLRRDYERL 181 Query: 188 IFNVKHTDLSPLGAAALAGTTFPIDREMTAQLMGFAEPYSNSLDAVSDRDFILEFLSNAS 247 +K D +PLG+AA+ T+FPI+RE+T +L+GF++ NS+DAVS RDFI E + + S Sbjct: 182 QDTLKRVDQNPLGSAAMTTTSFPINRELTTRLLGFSDYMKNSMDAVSARDFIAETVFDLS 241 Query: 248 ILMMHMSRMCEEVISWCSHEYQFVTLSDTFSTGSSIMPQKKNPDMAELIRGKSGRVYANL 307 +L +++SR+ EE+I W +HE+ V + D FS+ SSIMPQKKNPD+AE+ R K+ V L Sbjct: 242 MLAVNLSRISEEMILWSTHEFGIVEIPDEFSSTSSIMPQKKNPDVAEIARAKTSTVQGEL 301 Query: 308 FGLLTVMKALPLAYNKDLQEDKEGMFDTAETITVALDILAGMLSSMIVNDKHMAESTQKD 367 +L +MKALP YN+DLQE ++ +T+ + ++ GML + VN E + Sbjct: 302 VTILGIMKALPYTYNRDLQEVTPHLWRAVDTVLSMIRVVRGMLLGIRVNRNRALELAGAN 361 Query: 368 FSNATELADYLA-SKGMPFRQAHEIVGKLILECSKNG--------HYLQDVPLERYQTIS 418 F+ AT+LAD + +G+PFR AH IVG+L+ ++G YL +V LE Sbjct: 362 FATATDLADIIVRERGIPFRVAHRIVGRLVTRAIEDGLAPGDVDSVYLDEVSLEVTGRKL 421 Query: 419 DLIEEDVYETLKSHTAVERRHSLGGTGFEQVKWQIAEAK 457 +L E V + L V R GG E V+ + E K Sbjct: 422 ELDPELVEKALDPLENVRMRRIPGGPAPEMVRVAVEEMK 460 Lambda K H 0.318 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 506 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 460 Length of database: 468 Length adjustment: 33 Effective length of query: 427 Effective length of database: 435 Effective search space: 185745 Effective search space used: 185745 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate WP_010875908.1 MTH_RS01240 (argininosuccinate lyase)
to HMM TIGR00838 (argH: argininosuccinate lyase (EC 4.3.2.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00838.hmm # target sequence database: /tmp/gapView.42386.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00838 [M=455] Accession: TIGR00838 Description: argH: argininosuccinate lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.8e-204 663.7 0.8 8.9e-204 663.5 0.8 1.0 1 NCBI__GCF_000008645.1:WP_010875908.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000008645.1:WP_010875908.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 663.5 0.8 8.9e-204 8.9e-204 1 454 [. 3 463 .. 3 464 .. 0.99 Alignments for each domain: == domain 1 score: 663.5 bits; conditional E-value: 8.9e-204 TIGR00838 1 lwggRlkkeldkavaefnaslsfDkelaeaDiegsiahtkaLakagilteeeakklieaLeelkeevkegkle 73 l++gRl++++++++aef++sl+fD++++eaDie+++aht++La++gi+ ee a+k+i+aLe+l+ee+ e+ l+ NCBI__GCF_000008645.1:WP_010875908.1 3 LRAGRLNSGMEDEAAEFTSSLTFDHHIFEADIECNMAHTRMLAHEGIIPEEVAAKIIDALESLREEGIEA-LD 74 689******************************************************************6.** PP TIGR00838 74 levdaeDiHlavErelidkvgedvgkklhtgrsRnDqvatdlrlylrdkvkelaealkdllkalvekAekeve 146 +++++eDiH+avE+++++++ge++g +htg+sRnDqvatdlrl+lr+++++++++l+d+++++ ++A +++e NCBI__GCF_000008645.1:WP_010875908.1 75 MDPSVEDIHMAVENYVTARIGEEAG-FMHTGKSRNDQVATDLRLALRERIRTISRELLDFIDSISDLALDHTE 146 *********************8887.*********************************************** PP TIGR00838 147 tlmpgytHLqrAqPitlaHhllayaemlerDleRlldalkRvnksPlGsgAlagtsfeidrellaelLgFdav 219 t+m+gytHLq+AqP+tl+Hhl+aya++l+rD+eRl+d+lkRv+++PlGs+A+++tsf+i+rel+++lLgF+++ NCBI__GCF_000008645.1:WP_010875908.1 147 TVMVGYTHLQHAQPTTLGHHLMAYASSLRRDYERLQDTLKRVDQNPLGSAAMTTTSFPINRELTTRLLGFSDY 219 ************************************************************************* PP TIGR00838 220 vensldavsdRDfiiEllsaaallmvhlsrlaEelilfsseEfgfvelsdevssgssimPqKKnpDvaEliRg 292 ++ns+davs+RDfi+E+++++++l+v+lsr++Ee+il+s++Efg+ve++de+ss+ssimPqKKnpDvaE++R+ NCBI__GCF_000008645.1:WP_010875908.1 220 MKNSMDAVSARDFIAETVFDLSMLAVNLSRISEEMILWSTHEFGIVEIPDEFSSTSSIMPQKKNPDVAEIARA 292 ************************************************************************* PP TIGR00838 293 ktgrviGnltglltilKalPlaYnkDlqEdkealfdalktveellevvtgllkelkvnkerleeaakknfala 365 kt++v+G+l+++l i+KalP++Yn+DlqE++++l++a++tv ++++vv+g+l ++vn++r+ e+a +nfa+a NCBI__GCF_000008645.1:WP_010875908.1 293 KTSTVQGELVTILGIMKALPYTYNRDLQEVTPHLWRAVDTVLSMIRVVRGMLLGIRVNRNRALELAGANFATA 365 ************************************************************************* PP TIGR00838 366 tdlAdylvrk.GvPFReaheivGevvakaiekGk........kleeltleelqklsekleed.vlevldleea 428 tdlAd++vr+ G+PFR ah+ivG++v++aie+G+ +l+e++le++ + + +l+++ v+++ld+ e+ NCBI__GCF_000008645.1:WP_010875908.1 366 TDLADIIVRErGIPFRVAHRIVGRLVTRAIEDGLapgdvdsvYLDEVSLEVTGR-KLELDPElVEKALDPLEN 437 *********99**********************99**999999*********99.9******9********** PP TIGR00838 429 vekrdakGGtakeevekaieeakael 454 v++r++ GG+a+e+v+ a+ee+k+ + NCBI__GCF_000008645.1:WP_010875908.1 438 VRMRRIPGGPAPEMVRVAVEEMKSFI 463 ***********************976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (455 nodes) Target sequences: 1 (468 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 18.99 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory