Align Putative asparagine synthetase [glutamine-hydrolyzing] 1; EC 6.3.5.4 (uncharacterized)
to candidate WP_010876053.1 MTH_RS01915 asparagine synthase (glutamine-hydrolyzing)
Query= curated2:Q58516 (541 letters) >NCBI__GCF_000008645.1:WP_010876053.1 Length = 469 Score = 278 bits (710), Expect = 4e-79 Identities = 199/525 (37%), Positives = 289/525 (55%), Gaps = 91/525 (17%) Query: 1 MCSISGIIVKDNQISAKYSIDMMKILKHRGRDNSGLLLDDEVIYFNDF-EDVEDLEEEMI 59 MC+I+G D + + +M+ +L+HRG D +G+ D ++ EDV++ + Sbjct: 4 MCAIAGFRGDDAPVKVQ---EMLDVLRHRGPDATGIYHDSRIVIRTATGEDVKEAPQS-- 58 Query: 60 GNLSLAHNRLAIVGRYGVQPIPNEDETIWLVCNGEIYNYIELREYLKQNHEFRTDSDNEV 119 +++ HN L+IVG G QP+ + LV NGEIYN EL T SD+E+ Sbjct: 59 AEIAVGHNLLSIVG--GPQPVSGDGV---LVFNGEIYNQEELNW---------TGSDSEL 104 Query: 120 IIHLYE------EEKLE----ELDGDYAFAIYDKSKNVVRLARDMFGVKPLFYVDRDKYF 169 I+ L E E+ L ++DGDYAFA D R +D GVKPL++ Sbjct: 105 ILDLIEGHGGDLEDALRFTVNKIDGDYAFAYTDGENLASR--QDPVGVKPLYHSGE---- 158 Query: 170 AFASERKALWHLLINIDGCERDLDELNSKIKTLKPNSQLIYYLDDNRFEI-IEGFKKLEL 228 AFASE+KALW + + ++TL P +I N ++ + G + E Sbjct: 159 AFASEKKALWRIGLR-------------NVETLPPGHAMI-----NGVKVKLRGLPRAEP 200 Query: 229 NYMKERSYEEAKEYLDRALKNSVLKRVRGLDKVGIICSGGVDSSLIAKLASLYCEVILYA 288 + + EE +E L AL+ SV +RVRGLD+ ++ SGGVDS+L+A L + +V LY Sbjct: 201 S---DAEPEELRENLKSALRESVERRVRGLDEAALVFSGGVDSTLLAVLLDEHIDVRLYT 257 Query: 289 VGTENSEDLIYAERLAKDLNLKLRKKIISEEEYEEYVFKVAKAIDEVDLMKIGVGIPIYV 348 VG S D +A R A DL ++L ++E+ E + V AI+E +LMKIGV +P+Y+ Sbjct: 258 VGLPGSSDPQFASRAAADLGMELEVLEVTEDTIREALPHVLGAIEEYNLMKIGVAMPLYL 317 Query: 349 ASEMANEDGLKVVLSGQGADELFGGYARHERIYRERGEEELKKELLKDVYNLYKVNLERD 408 ASE A+ DG +V+ SGQGADELF GY R+ R+ E L+ L D+ N++ VNLERD Sbjct: 318 ASEAASADGYRVMFSGQGADELFAGYHRYRRLL---AEGRLEDALRHDLENIHHVNLERD 374 Query: 409 DHCTMANGVELRVPFLDEEVVEIALSIPIEYKMSELSNRPYAESNISLKSEPINGLKNTN 468 D TMAN VELRVPFLD +++ +AL+IP + K I G ++ Sbjct: 375 DAVTMANSVELRVPFLDLQLIGVALTIPADLK--------------------IRGPED-- 412 Query: 469 LNIKCVRSVRKKILRDVASQY-LPDYIAYRPKKAAQYGSGGEKMI 512 +RK+ILR+ A + +P+YIA RPKKAAQYGSG +K++ Sbjct: 413 -------ELRKRILREAALEMGVPEYIAMRPKKAAQYGSGIDKVL 450 Lambda K H 0.318 0.138 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 599 Number of extensions: 33 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 541 Length of database: 469 Length adjustment: 34 Effective length of query: 507 Effective length of database: 435 Effective search space: 220545 Effective search space used: 220545 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
Align candidate WP_010876053.1 MTH_RS01915 (asparagine synthase (glutamine-hydrolyzing))
to HMM TIGR01536 (asnB: asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01536.hmm # target sequence database: /tmp/gapView.20326.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01536 [M=517] Accession: TIGR01536 Description: asn_synth_AEB: asparagine synthase (glutamine-hydrolyzing) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-116 375.5 0.0 8.9e-90 288.0 0.0 2.7 2 lcl|NCBI__GCF_000008645.1:WP_010876053.1 MTH_RS01915 asparagine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000008645.1:WP_010876053.1 MTH_RS01915 asparagine synthase (glutamine-hydrolyzing) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 288.0 0.0 8.9e-90 8.9e-90 1 383 [. 5 355 .. 5 356 .. 0.94 2 ! 85.3 0.2 2.5e-28 2.5e-28 435 515 .. 354 439 .. 350 441 .. 0.93 Alignments for each domain: == domain 1 score: 288.0 bits; conditional E-value: 8.9e-90 TIGR01536 1 CgiagivdlkakakeeeeaikemletlahRGPDaegvwkd...............e.keenailghrRL 53 C+iag+ ++a +++eml++l+hRGPDa+g+++d + ++++ ++gh+ L lcl|NCBI__GCF_000008645.1:WP_010876053.1 5 CAIAGFRGDDAP-----VKVQEMLDVLRHRGPDATGIYHDsrivirtatgedvkeApQSAEIAVGHNLL 68 9******99875.....6789********************************9643455556666666 PP TIGR01536 54 aiidlsegaQPlsnekevvivfnGEIYNheeLreeleekGyeFetksDtEViLaayeew......g.ee 115 +i+ QP+s+++ v+vfnGEIYN+eeL+ +t sD+E+iL+++e + + + lcl|NCBI__GCF_000008645.1:WP_010876053.1 69 SIVGG---PQPVSGDG--VLVFNGEIYNQEELN----------WTGSDSELILDLIEGHggdledAlRF 122 66654...8*******..***************..........9***************9999986699 PP TIGR01536 116 lverLeGmFAfalwdekkgelflaRDrlGikPLYyaseqgkllfaSEiKallalk..eikaeldkeala 182 +v++++G++Afa++d ++l++++D++G+kPLY++ e +faSE+Kal+++ ++++ ++++a++ lcl|NCBI__GCF_000008645.1:WP_010876053.1 123 TVNKIDGDYAFAYTDG--ENLASRQDPVGVKPLYHSGE----AFASEKKALWRIGlrNVETLPPGHAMI 185 ****************..9*******************....9************99************ PP TIGR01536 183 elltlqlvptektlfkevkelepakaldgeekleeywevekeevkeseeelveelrelledavkkrlva 251 ++++++ +++ ++ep++a+ +ee +e+ l+++l+++v++r+++ lcl|NCBI__GCF_000008645.1:WP_010876053.1 186 NGVKVK--------LRGLPRAEPSDAE-PEELREN-------------------LKSALRESVERRVRG 226 ******........59**********8.8777775...................*************** PP TIGR01536 252 dvpvgvllSGGlDSslvaaiakkeaksevktFsigfedskdldeskaarkvadelgtehkevliseeev 320 +++++++SGG+DS+l+a++++++++ v+++++g+++s+d + +a+++a++lg+e++ ++++e+++ lcl|NCBI__GCF_000008645.1:WP_010876053.1 227 LDEAALVFSGGVDSTLLAVLLDEHID--VRLYTVGLPGSSDPQ---FASRAAADLGMELEVLEVTEDTI 290 ************************99..***************...*********************** PP TIGR01536 321 lkeleevilale..eptairasiplyllsklarekgvkVvLsGeGaDElfgGYeyfreakaeeal 383 ++l++v+ a+e ++++i ++plyl+s++a+++g++V++sG+GaDElf+GY+++r+ ae +l lcl|NCBI__GCF_000008645.1:WP_010876053.1 291 REALPHVLGAIEeyNLMKIGVAMPLYLASEAASADGYRVMFSGQGADELFAGYHRYRRLLAEGRL 355 ************9*********************************************9998776 PP == domain 2 score: 85.3 bits; conditional E-value: 2.5e-28 TIGR01536 435 eleellrldlelllsdllrakDrvsmahslEvRvPflDkelvelalsippelklr...dgkeKvlLrea 500 +le++lr+dle++++ +l+++D v+ma+s+E+RvPflD +l+ +al+ip++lk+r d+ +K++Lrea lcl|NCBI__GCF_000008645.1:WP_010876053.1 354 RLEDALRHDLENIHHVNLERDDAVTMANSVELRVPFLDLQLIGVALTIPADLKIRgpeDELRKRILREA 422 68999**************************************************999999******** PP TIGR01536 501 aee.llPeeileR.kKe 515 a e +Pe+i++R kK+ lcl|NCBI__GCF_000008645.1:WP_010876053.1 423 ALEmGVPEYIAMRpKKA 439 99989********5555 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (517 nodes) Target sequences: 1 (469 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.07u 0.01s 00:00:00.08 Elapsed: 00:00:00.07 # Mc/sec: 3.25 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory