Align aspartate kinase (EC 2.7.2.4) (characterized)
to candidate WP_010876437.1 MTH_RS03770 aspartate kinase
Query= BRENDA::P08495 (408 letters) >NCBI__GCF_000008645.1:WP_010876437.1 Length = 406 Score = 174 bits (441), Expect = 4e-48 Identities = 130/411 (31%), Positives = 219/411 (53%), Gaps = 16/411 (3%) Query: 1 MGLIVQKFGGTSVGSVEKIQNAANRAIAEKQKGHQVVVVVSAMGKSTDELVSLA-KAISD 59 M LIV KFGGTS+G+ +I+ AA + E KG +VVVVVSA+ K+TDEL+ + +A+ D Sbjct: 1 MELIVAKFGGTSIGNGRRIKKAARSVVKEYMKGRKVVVVVSAINKTTDELLQIVDEAMED 60 Query: 60 QPSKREMDMLLATGEQVTISLLSMALQEKGYDAVSYTGW--QAGIRTEAIHGNARI---- 113 +++++ +++ GE ++ + S A++ G + + + I T++ NA++ Sbjct: 61 AVTEKQLAEIVSMGEMTSVRIFSSAIEALGVKSEYIDPFMDEWPIITDSNLLNAKVDFEA 120 Query: 114 TDIDTSVLADQLEKGKIVIVAGFQGMTEDCEITTLGRGGSDTTAVALAAALKADKCDIYT 173 T+ + L L++G I +V GF G + ITTLGRGGSD TA L LKAD+ I T Sbjct: 121 TEEKSRELLKLLDQGIIPVVCGFLGRDPNGYITTLGRGGSDITAFLLGHCLKADEVIIVT 180 Query: 174 DVPGVFTTDPRYVKSARKLEGISYDEMLELANLGAGVLHPRAVEFAKNYQVPLEVRSSTE 233 DV GV +TDP ++ A+KL+ IS +EM +LA GA VLHP A+++ K+ + ++ Sbjct: 181 DVGGVMSTDPNKLQGAKKLDKISVEEMRDLATHGAQVLHPHALKY-KDPDIKAKIIGFEH 239 Query: 234 TEAGTLIEEESSMEQNLIVRGIAFE-DQITRVTIYG--LTSGLTTLSTIFTTLAKRNINV 290 + E +N +V+ D I+ V + G + + L+ + + LA+ +IN+ Sbjct: 240 GDLSAPGTEIIGPSKNKMVKTTTLNPDPISVVAVVGEKILNKPGILARLTSRLAENSINI 299 Query: 291 DIIIQTQAEDKTGISFSVKTEDADQTVAVLEEYKDA-LEFEKIETESKLAKVSIVGSGMV 349 I I T + ++ V +DAD+ +L + A + + +A ++I + Sbjct: 300 -IGIST---GQNSVTIFVDKKDADEAHRLLHDVVIADDDLSSLSLGRDIAMITISSPDFI 355 Query: 350 SNPGVAAEMFAVLAQKNILIKMVSTSEIKVSTVVSENDMVKAVESLHDAFE 400 PG+ +E+ L ++ I +S+S+ V V ND KA E + E Sbjct: 356 DTPGIISEITKPLRDNDLNIVEISSSQTSVVIFVDWNDGKKAYELVRGVLE 406 Lambda K H 0.313 0.128 0.337 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 336 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 408 Length of database: 406 Length adjustment: 31 Effective length of query: 377 Effective length of database: 375 Effective search space: 141375 Effective search space used: 141375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.9 bits)
Align candidate WP_010876437.1 MTH_RS03770 (aspartate kinase)
to HMM TIGR00656 (aspartate kinase, monofunctional class (EC 2.7.2.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00656.hmm # target sequence database: /tmp/gapView.19940.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00656 [M=407] Accession: TIGR00656 Description: asp_kin_monofn: aspartate kinase, monofunctional class Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-159 515.4 4.2 6.1e-159 515.3 4.2 1.0 1 lcl|NCBI__GCF_000008645.1:WP_010876437.1 MTH_RS03770 aspartate kinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000008645.1:WP_010876437.1 MTH_RS03770 aspartate kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 515.3 4.2 6.1e-159 6.1e-159 1 404 [. 1 405 [. 1 406 [] 0.99 Alignments for each domain: == domain 1 score: 515.3 bits; conditional E-value: 6.1e-159 TIGR00656 1 veliVqKFGGtsvgsserikkaakivlkelkegkkvvVVvSAmskvtdelvelaellklleaisdeisp 69 +eliV+KFGGts+g+++rikkaa++v+ke+++g+kvvVVvSA++k+tdel+++++ ea++d++++ lcl|NCBI__GCF_000008645.1:WP_010876437.1 1 MELIVAKFGGTSIGNGRRIKKAARSVVKEYMKGRKVVVVVSAINKTTDELLQIVD-----EAMEDAVTE 64 79****************************************************8.....********* PP TIGR00656 70 rerdelvsvGEllssallssalrelgvkaeald..gkeagilTddefgnAkikelate...erLlelLe 133 ++ +e+vs+GE++s++++ssa+++lgvk+e++d ++e++i+Td+++ nAk++++ate ++Ll+lL+ lcl|NCBI__GCF_000008645.1:WP_010876437.1 65 KQLAEIVSMGEMTSVRIFSSAIEALGVKSEYIDpfMDEWPIITDSNLLNAKVDFEATEeksRELLKLLD 133 *********************************************************999999****** PP TIGR00656 134 egiivvvaGFiGateeGeiTtLGRGGSDltAallaaalkAdrveiyTDVeGvyttDPrvveeakkidki 202 +gii+vv+GF+G++ +G+iTtLGRGGSD+tA+ll+++lkAd+v i+TDV Gv++tDP++++ akk+dki lcl|NCBI__GCF_000008645.1:WP_010876437.1 134 QGIIPVVCGFLGRDPNGYITTLGRGGSDITAFLLGHCLKADEVIIVTDVGGVMSTDPNKLQGAKKLDKI 202 ********************************************************************* PP TIGR00656 203 syeEalelAtlGakvlhpralela.veakvpilvrsskeke.egTlitnkkensslvkaialekn.var 268 s+eE+++lAt+Ga+vlhp+al+++ ++k++i+++++ + + gT+i+ ++n+ +vk+++l+++ +++ lcl|NCBI__GCF_000008645.1:WP_010876437.1 203 SVEEMRDLATHGAQVLHPHALKYKdPDIKAKIIGFEHGDLSaPGTEIIGPSKNK-MVKTTTLNPDpISV 270 ************************99***************9************.************** PP TIGR00656 269 ltvegegmlgkrgilaeifkaLaeeeinvdlisqtesetsislvvdeedvdeakkaLkeesgaae.les 336 ++v+ge++l+k+gila+++++Lae++in++ is+++ +s++++vd++d+dea+++L+++++a++ l+s lcl|NCBI__GCF_000008645.1:WP_010876437.1 271 VAVVGEKILNKPGILARLTSRLAENSINIIGISTGQ--NSVTIFVDKKDADEAHRLLHDVVIADDdLSS 337 ************************************..***********************99888*** PP TIGR00656 337 leveedlavvsivgaglveapGvaseifkaleekninilmisssetkisvlvdekdaekavrklhekl 404 l++ +d+a+++i++ +++++pG++sei+k+l+++++ni++isss+t+++++vd++d +ka+++++ +l lcl|NCBI__GCF_000008645.1:WP_010876437.1 338 LSLGRDIAMITISSPDFIDTPGIISEITKPLRDNDLNIVEISSSQTSVVIFVDWNDGKKAYELVRGVL 405 ****************************************************************9877 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (407 nodes) Target sequences: 1 (406 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 6.67 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory